• Gene id: 91614

Gene Summary

• Gene Symbol: DEPDC7   Gene   UCSC   Ensembl
• Aliases: TR2, dJ85M6.4
• Gene name: DEP domain containing 7
• Alternate names: DEP domain-containing protein 7, dJ85M6.4 (novel 58.3 KDA protein), novel 58.3 KDA protein,
• Gene location: 11p13 (33015877: 33033581)     Exons: 10     NC_000011.10
• OMIM: 612294

Protein Summary

• Protein general information: Q96QD5  
  • Name: DEP domain containing protein 7 (Protein TR2/D15)
  • Length: 511  
  • Mass: 58310
  • Tissue specificity: Expressed in liver. {ECO
• Sequence:

  MATVQEKAAALNLSALHSPAHRPPGFSVAQKPFGATYVWSSIINTLQTQVEVKKRRHRLKRHNDCFVGSEAVDVI
  FSHLIQNKYFGDVDIPRAKVVRVCQALMDYKVFEAVPTKVFGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKL
  YSPARYADALFKSSDIRSASLEDLWENLSLKPANSPHVNISATLSPQVINEVWQEETIGRLLQLVDLPLLDSLLK
  QQEAVPKIPQPKRQSTMVNSSNYLDRGILKAYSDSQEDEWLSAAIDCLEYLPDQMVVEISRSFPEQPDRTDLVKE
  LLFDAIGRYYSSREPLLNHLSDVHNGIAELLVNGKTEIALEATQLLLKLLDFQNREEFRRLLYFMAVAANPSEFK
  LQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVFKIPGTLHKIVSVKLMAIQNGRDPNRDAGYI
  YCQRIDQRDYSNNTEKTTKDELLNLLKTLDEDSKLSAKEKKKLLGQFYKCHPDIFIEHFGD

• Structural information:
  • Protein Domains: (46..13-)
    (/note="DEP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00066"-)
  • Interpro: IPR000591  IPR036388  IPR036390  
  • Prosite: PS50186
  • STRING: ENSP00000241051
• Other Databases: GeneCards:  DEPDC7  Malacards:  DEPDC7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R