|
Gene id |
91582 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
RPS19BP1 Gene UCSC Ensembl |
|
Aliases |
AROS, S19BP |
|
Gene name |
ribosomal protein S19 binding protein 1 |
|
Alternate names |
active regulator of SIRT1, 40S ribosomal protein S19-binding protein 1, RPS19-binding protein 1, homolog of mouse S19 binding protein, |
|
Gene location |
22q13.1 (39532747: 39529092) Exons: 5 NC_000022.11
|
|
OMIM |
610225 |
Protein Summary
|
| Protein general information
| Q86WX3
Name: Active regulator of SIRT1 (40S ribosomal protein S19 binding protein 1) (RPS19 binding protein 1) (S19BP)
Length: 136 Mass: 15434
Tissue specificity: Widely expressed (at protein level). {ECO
|
| Sequence |
MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVN LKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
|
| Structural information |
|
| Other Databases |
GeneCards: RPS19BP1  Malacards: RPS19BP1 |
|
|
|
|
| Associated diseases |
References |
| Aberrant CpGs in Low Motility Sperm | MIK: 21674046 |
| Cryptorchidism | MIK: 28606200 |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 21674046 |
Aberrant C pGs in Low Motility Sperm
|
|
|
18
|
Male infertility |
GSE26881
|
Show abstract |
| 28606200 |
Cryptorchi dism
|
|
|
Monozgotic twin s (1 control, I cwith cryptorc hidism)
|
Male infertility |
MeDIP-Seq
|
Show abstract |
|