• Gene id: 91544

Gene Summary

• Gene Symbol: UBXN11   Gene   UCSC   Ensembl
• Aliases: COA-1, PP2243, SOC, SOCI, UBXD5
• Gene name: UBX domain protein 11
• Alternate names: UBX domain-containing protein 11, UBX domain-containing protein 5, colorectal tumor-associated antigen COA-1, colorectal tumor-associated antigen-1, socius,
• Gene location: 1p36.11 (26318264: 26282281)     Exons: 17     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein with a divergent C-terminal UBX domain. The homologous protein in the rat interacts with members of the Rnd subfamily of Rho GTPases at the cell periphery through its C-terminal region. It also interacts with several heterotrim
• OMIM: 612147

Protein Summary

• Protein general information: Q5T124  
  • Name: UBX domain containing protein 11 (Colorectal tumor associated antigen COA 1) (Socius) (UBX domain containing protein 5)
  • Length: 520  
  • Mass: 57373
• Sequence:

  MSSPLASLSKTRKVPLPSEPMNPGRRGIRIYGDEDEVDMLSDGCGSEEKISVPSCYGGIGAPVSRQVPASHDSEL
  MAFMTRKLWDLEQQVKAQTDEILSKDQKIAALEDLVQTLRPHPAEATLQRQEELETMCVQLQRQVREMERFLSDY
  GLQWVGEPMDQEDSESKTVSEHGERDWMTAKKFWKPGDSLAPPEVDFDRLLASLQDLSELVVEGDTQVTPVPGGA
  RLRTLEPIPLKLYRNGIMMFDGPFQPFYDPSTQRCLRDILDGFFPSELQRLYPNGVPFKVSDLRNQVYLEDGLDP
  FPGEGRVVGRQLMHKALDRVEEHPGSRMTAEKFLNRLPKFVIRQGEVIDIRGPIRDTLQNCCPLPARIQEIVVET
  PTLAAERERSQESPNTPAPPLSMLRIKSENGEQAFLLMMQPDNTIGDVRALLAQARVMDASAFEIFSTFPPTLYQ
  DDTLTLQAAGLVPKAALLLRARRAPKSSLKFSPGPCPGPGPGPSPGPGPGPSPGPGPGPSPCPGPSPSPQ

• Structural information:
  • Protein Domains: (230..29-)
    (/note="SEP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00732-)
    (392..46-)
    (/note="UBX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00215"-)
  • Interpro: IPR036241  IPR012989  IPR029071  IPR001012  
  • Prosite: PS51399 PS50033
  • STRING: ENSP00000363339
• Other Databases: GeneCards:  UBXN11  Malacards:  UBXN11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043130	ubiquitin binding	IBA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq