Search Result
| Gene id | 91227 | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||
| Gene Symbol | GGTLC2 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||
| Aliases | GGTL4 | ||||||||||||||||||||||||||||||||||||
| Gene name | gamma-glutamyltransferase light chain 2 | ||||||||||||||||||||||||||||||||||||
| Alternate names | glutathione hydrolase light chain 2, gamma-glutamyltransferase-like 4, gamma-glutamyltransferase-like protein 4, | ||||||||||||||||||||||||||||||||||||
| Gene location |
22q11.22 (108091643: 108084204) Exons: 5 NC_000023.11 |
||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a protein related to enzymes that cleaves gamma-glutamyl peptide bonds in glutathione and other peptides. Unlike similar proteins, the encoded protein contains only the light chain portion and may not have catalytic activity. Alternative |
||||||||||||||||||||||||||||||||||||
| OMIM | 612339 | ||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||
| Protein general information | Q14390 Name: Glutathione hydrolase light chain 2 (Gamma glutamyltransferase light chain 2) (Gamma glutamyltransferase like protein 4) Length: 218 Mass: 23661 Tissue specificity: Placenta and sigmoid tissues. | ||||||||||||||||||||||||||||||||||||
| Sequence |
MTSEFFAAQLRAQISDDTTHPISYYKPEFYTPVDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSEILFND EMDDFSSPNITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQPPSHADHTPMPQAIIYNLWFGYDVKRAVEE PRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY | ||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: GGTLC2  Malacards: GGTLC2 | ||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||