• Gene id: 9120

Gene Summary

• Gene Symbol: SLC16A6   Gene   UCSC   Ensembl
• Aliases: MCT6, MCT7
• Gene name: solute carrier family 16 member 6
• Alternate names: monocarboxylate transporter 7, breast cancer protein BCY5, monocarboxylate transporter 6, solute carrier family 16, member 6 (monocarboxylic acid transporter 7),
• Gene location: 17q24.2 (68291438: 68267025)     Exons: 11     NC_000017.11
• OMIM: 602919

Protein Summary

• Protein general information: O15403  
  • Name: Monocarboxylate transporter 7 (MCT 7) (Monocarboxylate transporter 6) (MCT 6) (Solute carrier family 16 member 6)
  • Length: 523  
  • Mass: 57393
• Sequence:

  MTQNKLKLCSKANVYTEVPDGGWGWAVAVSFFFVEVFTYGIIKTFGVFFNDLMDSFNESNSRISWIISICVFVLT
  FSAPLATVLSNRFGHRLVVMLGGLLVSTGMVAASFSQEVSHMYVAIGIISGLGYCFSFLPTVTILSQYFGKRRSI
  VTAVASTGECFAVFAFAPAIMALKERIGWRYSLLFVGLLQLNIVIFGALLRPIFIRGPASPKIVIQENRKEAQYM
  LENEKTRTSIDSIDSGVELTTSPKNVPTHTNLELEPKADMQQVLVKTSPRPSEKKAPLLDFSILKEKSFICYALF
  GLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMAIAEVFGRIGAGFVLNREPIRKIYIELICVILLTVSLFA
  FTFATEFWGLMSCSIFFGFMVGTIGGTHIPLLAEDDVVGIEKMSSAAGVYIFIQSIAGLAGPPLAGLLVDQSKIY
  SRAFYSCAAGMALAAVCLALVRPCKMGLCQHHHSGETKVVSHRGKTLQDIPEDFLEMDLAKNEHRVHVQMEPV

• Structural information:
  • Interpro: IPR030766  IPR011701  IPR020846  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000319991
• Other Databases: GeneCards:  SLC16A6  Malacards:  SLC16A6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008028	monocarboxylic acid transmembrane transporter activity	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008028	monocarboxylic acid transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0015718	monocarboxylic acid transport	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray