• Gene id: 9117

Gene Summary

• Gene Symbol: SEC22C   Gene   UCSC   Ensembl
• Aliases: SEC22L3
• Gene name: SEC22 homolog C, vesicle trafficking protein
• Alternate names: vesicle-trafficking protein SEC22c, SEC22 vesicle trafficking protein homolog C, SEC22 vesicle trafficking protein-like 3, SEC22 vesicle trafficking protein-like protein C, secretion deficient 22C,
• Gene location: 3p22.1 (79691096: 79584873)     Exons: 13     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the SEC22 family of vesicle trafficking proteins. The encoded protein is localized to the endoplasmic reticulum and may play a role in the early stages of ER-Golgi protein trafficking. Alternatively spliced transcript variant
• OMIM: 604028

Protein Summary

• Protein general information: Q9BRL7  
  • Name: Vesicle trafficking protein SEC22c (SEC22 vesicle trafficking protein homolog C) (SEC22 vesicle trafficking protein like 3)
  • Length: 303  
  • Mass: 34269
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MSVIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHFSSFGDVACMAICS
  CQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPP
  AVLTLEDTDVANGVMNGHTPMHLEPAPNFRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNIL
  AFLVPFVACIFQCYLYLFYSPARTMKVVLMLLFICLGNMYLHGLRNLWQILFHIGVAFLSSYQILTRQLQEKQSD
  CGV

• Structural information:
  • Protein Domains: (8..11-)
    (/note="Longin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00231"-)
  • Interpro: IPR011012  IPR010908  
  • Prosite: PS50859
  • STRING: ENSP00000264454
• Other Databases: GeneCards:  SEC22C  Malacards:  SEC22C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)