Search Result
| Gene id | 9103 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | FCGR2C Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | CD32, CD32C, CDW32, FCG2, FCRIIC, IGFR2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | Fc fragment of IgG receptor IIc (gene/pseudogene) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | low affinity immunoglobulin gamma Fc region receptor II-c, Fc fragment of IgG, low affinity IIc, receptor for (CD32), Fc gamma receptor IIC, IgG Fc receptor II-c, fc-gamma-RIIc, immunoglobulin G Fc receptor II-c, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
1q23.3 (161581338: 161601219) Exons: 7 NC_000001.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes one of three members of a family of low-affinity immunoglobulin gamma Fc receptors found on the surface of many immune response cells. The encoded protein is a transmembrane glycoprotein and may be involved in phagocytosis and clearing o |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | P31995 Name: Low affinity immunoglobulin gamma Fc region receptor II c (IgG Fc receptor II c) (CDw32) (Fc gamma RII c) (Fc gamma RIIc) (FcRII c) (CD antigen CD32) Length: 323 Mass: 35578 Tissue specificity: Isoform IIC1 is detected in monocytes, macrophages, polymorphonuclear cells and natural killer cells. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTH SPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVL RCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGII VAVVTGIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPR APTDDDKNIYLTLPPNDHVNSNN | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: FCGR2C  Malacards: FCGR2C | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
KEGG pathways
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||