• Gene id: 90861

Gene Summary

• Gene Symbol: JPT2   Gene   UCSC   Ensembl
• Aliases: C16orf34, HN1L, L11
• Gene name: Jupiter microtubule associated homolog 2
• Alternate names: jupiter microtubule associated homolog 2, CRAMP_1 like, HN1 like, HN1-like protein, hematological and neurological expressed 1 like, hematological and neurological expressed 1-like protein,
• Gene location: 16p13.3 (1678278: 1702085)     Exons: 5     NC_000016.10
• OMIM: 607995

Protein Summary

• Protein general information: Q9H910  
  • Name: Jupiter microtubule associated homolog 2 (Hematological and neurological expressed 1 like protein) (HN1 like protein)
  • Length: 190  
  • Mass: 20063
  • Tissue specificity: Expressed in liver, kidney, prostate, testis and uterus. {ECO
• Sequence:

  MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDES
  TPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGP
  AKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY

• Structural information:
  • Interpro: IPR033335  
  • STRING: ENSP00000248098
• Other Databases: GeneCards:  JPT2  Malacards:  JPT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq