Search Result
| Gene id | 9086 | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||
| Gene Symbol | EIF1AY Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||
| Aliases | eIF-4C | ||||||||||||||||||||||||||||||||||||
| Gene name | eukaryotic translation initiation factor 1A Y-linked | ||||||||||||||||||||||||||||||||||||
| Alternate names | eukaryotic translation initiation factor 1A, Y-chromosomal, eIF-1A Y isoform, eukaryotic translation initiation factor 1A, Y chromosome, eukaryotic translation initiation factor 4C, | ||||||||||||||||||||||||||||||||||||
| Gene location |
Yq11.223 (20575710: 20593153) Exons: 7 NC_000024.10 |
||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene is located on the non-recombining region of the Y chromosome. It encodes a protein related to eukaryotic translation initiation factor 1A (EIF1A), which may function in stabilizing the binding of the initiator Met-tRNA to 40S ribosomal subunits. |
||||||||||||||||||||||||||||||||||||
| OMIM | 400014 | ||||||||||||||||||||||||||||||||||||
SNPs |
rs13447352 Strand: Allele origin: Allele change: Mutation type: snv NC_000024.10 g.20587967A>C NC_000024.9 g.22749853A>C|SEQ=[A/C]|GENE=EIF1AY |
||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||
| Protein general information | O14602 Name: Eukaryotic translation initiation factor 1A, Y chromosomal (eIF 1A Y isoform) (Eukaryotic translation initiation factor 4C) (eIF 4C) Length: 144 Mass: 16442 Tissue specificity: Ubiquitous. | ||||||||||||||||||||||||||||||||||||
| Sequence |
MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSD IILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI | ||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: EIF1AY  Malacards: EIF1AY | ||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
KEGG pathways
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||