• Gene id: 90826

Gene Summary

• Gene Symbol: PRMT9   Gene   UCSC   Ensembl
• Aliases: PRMT10
• Gene name: protein arginine methyltransferase 9
• Alternate names: protein arginine N-methyltransferase 9, protein arginine N-methyltransferase 10, protein arginine methyltransferase 10 (putative), putative protein arginine N-methyltransferase 10, putative protein arginine N-methyltransferase 9,
• Gene location: 4q31.23 (147684229: 147635649)     Exons: 15     NC_000004.12
• Gene summary(Entrez): This gene encodes a type II methyltransferase. Post-translational modification of target proteins by PRMTs plays an important regulatory role in many biological processes, whereby PRMTs methylate arginine residues by transferring methyl groups from S-aden

Protein Summary

• Protein general information: Q6P2P2  
  • Name: Protein arginine N methyltransferase 9 (Protein arginine N methyltransferase 10) (EC 2.1.1.320)
  • Length: 845  
  • Mass: 94501
• Sequence:

  MSNSRPRSRRDAGGGAGAAGRDELVSRSLQSAEHCLGVQDFGTAYAHYLLVLSLAPELKHDVKETFQYTLFRWAE
  ELDALSRIQDLLGCYEQALELFPDDEVICNSMGEHLFRMGFRDEAAGYFHKAVKLNPDFSDAKENFYRVANWLVE
  RWHFIMLNDTKRNTIYNAAIQKAVCLGSKSVLDIGAGTGILSMFAKKAGAHSVYACELSKTMYELACDVVAANKM
  EAGIKLLHTKSLDIEIPKHIPERVSLVVTETVDAGLFGEGIVESLIHAWEHLLLQPKTKGESANCEKYGKVIPAS
  AVIFGMAVECAEIRRHHRVGIKDIAGIHLPTNVKFQSPAYSSVDTEETIEPYTTEKMSRVPGGYLALTECFEIMT
  VDFNNLQELKSLATKKPDKIGIPVIKEGILDAIMVWFVLQLDDEHSLSTSPSEETCWEQAVYPVQDLADYWIKPG
  DHVMMEVSCQDCYLRIQSISVLGLECEMDVAKSFTQNKDLLSLGNEAELCSALANLQTSKPDAVEQTCILESTEI
  ALLNNIPYHEGFKMAMSKVLSSLTPEKLYQTMDTHCQNEMSSGTGQSNTVQNILEPFYVLDVSEGFSVLPVIAGT
  LGQVKPYSSVEKDQHRIALDLISEANHFPKETLEFWLRHVEDESAMLQRPKSDKLWSIIILDVIEPSGLIQQEIM
  EKAAISRCLLQSGGKIFPQYVLMFGLLVESQTLLEENAVQGTERTLGLNIAPFINQFQVPIRVFLDLSSLPCIPL
  SKPVELLRLDLMTPYLNTSNREVKVYVCKSGRLTAIPFWYHMYLDEEIRLDTSSEASHWKQAAVVLDNPIQVEMG
  EELVLSIQHHKSNVSITVKQ

• Structural information:
  • Protein Domains: (137..46-)
    PRMT-type (/note="SAM-dependent-MTase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01015-)
    (530..84-)
    PRMT-type (/note="SAM-dependent-MTase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01015"-)
  • Interpro: IPR025799  IPR029063  IPR013026  IPR011990  IPR019734  
  • Prosite: PS51678 PS50005 PS50293
  • PDB: 6PDM
  • PDBsum: 6PDM
  • STRING: ENSP00000314396
• Other Databases: GeneCards:  PRMT9  Malacards:  PRMT9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016274	protein-arginine N-methyltransferase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016274	protein-arginine N-methyltransferase activity	IMP	molecular function
GO:0035243	protein-arginine omega-N symmetric methyltransferase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006397	mRNA processing	IMP	biological process
GO:0016274	protein-arginine N-methyltransferase activity	IEA	molecular function
GO:0018216	peptidyl-arginine methylation	IEA	biological process
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0035243	protein-arginine omega-N symmetric methyltransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0035246	peptidyl-arginine N-methylation	IEA	biological process
GO:0019918	peptidyl-arginine methylation, to symmetrical-dimethyl arginine	IEA	biological process
GO:0019918	peptidyl-arginine methylation, to symmetrical-dimethyl arginine	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq