• Gene id: 90809

Gene Summary

• Gene Symbol: PIP4P1   Gene   UCSC   Ensembl
• Aliases: C14orf9, TMEM55B
• Gene name: phosphatidylinositol-4,5-bisphosphate 4-phosphatase 1
• Alternate names: type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase, ptdIns-4,5-P(2) 4-phosphatase type I, ptdIns-4,5-P2 4-Ptase I, transmembrane protein 55B, type 1 PtdIns-4,5-P2 4-Ptase, type I PtdIns-4,5-P(2) 4-phosphatase, type I phosphatidylinositol-4,5-bisphosphat,
• Gene location: 14q11.2 (20461611: 20457680)     Exons: 7     NC_000014.9
• Gene summary(Entrez): TMEM55B catalyzes the degradation of phosphatidylinositol 4,5-bisphosphate (PtdIns-4,5-P2) by removing the 4-phosphate (Ungewickell et al., 2005 [PubMed 16365287]).[supplied by OMIM, Mar 2008]
• OMIM: 301003

Protein Summary

• Protein general information: Q86T03  
  • Name: Type 1 phosphatidylinositol 4,5 bisphosphate 4 phosphatase (Type 1 PtdIns 4,5 P2 4 Ptase) (EC 3.1.3.78) (PtdIns 4,5 P2 4 Ptase I) (Transmembrane protein 55B)
  • Length: 277  
  • Mass: 29470
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAADGERSPLLSEPIDGGAGGNGLVGPGGSGAGPGGGLTPSAPPYGAAFPPFPEGHPAVLPGEDPPPYSPLTSPD
  SGSAPMITCRVCQSLINVEGKMHQHVVKCGVCNEATPIKNAPPGKKYVRCPCNCLLICKVTSQRIACPRPYCKRI
  INLGPVHPGPLSPEPQPMGVRVICGHCKNTFLWTEFTDRTLARCPHCRKVSSIGRRYPRKRCICCFLLGLLLAVT
  ATGLAFGTWKHARRYGGIYAAWAFVILLAVLCLGRALYWACMKVSHPVQNFS

• Structural information:
  • Interpro: IPR019178  
  • STRING: ENSP00000381102
• Other Databases: GeneCards:  PIP4P1  Malacards:  PIP4P1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006991	response to sterol depletion	IDA	biological process
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0006991	response to sterol depletion	IDA	biological process
GO:0032418	lysosome localization	IMP	biological process
GO:0070070	proton-transporting V-type ATPase complex assembly	ISS	biological process
GO:1904263	positive regulation of TORC1 signaling	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008203	cholesterol metabolic process	IMP	biological process
GO:0030670	phagocytic vesicle membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0034597	phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity	IEA	molecular function
GO:0046856	phosphatidylinositol dephosphorylation	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0034597	phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity	IDA	molecular function
GO:0031902	late endosome membrane	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0046856	phosphatidylinositol dephosphorylation	IDA	biological process
GO:0034597	phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006644	phospholipid metabolic process	TAS	biological process
GO:0031902	late endosome membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1904263	positive regulation of TORC1 signaling	IEA	biological process
GO:0070070	proton-transporting V-type ATPase complex assembly	IEA	biological process
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04070	Phosphatidylinositol signaling system

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881