Search Result
| Gene id | 9068 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | ANGPTL1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | ANG3, ANGPT3, ARP1, AngY, UNQ162, dJ595C2.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | angiopoietin like 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | angiopoietin-related protein 1, ANG-3, angioarrestin, angiopoietin 3, angiopoietin Y1, angiopoietin-like protein 1, dJ595C2.2 (angiopoietin Y1), | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
1q25.2 (178871076: 178849534) Exons: 19 NC_000001.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. The p |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 603874 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | O95841 Name: Angiopoietin related protein 1 (Angiopoietin 3) (ANG 3) (Angiopoietin like protein 1) Length: 491 Mass: 56720 Tissue specificity: Highly expressed in adrenal gland, placenta, thyroid gland, heart, skeletal muscle and small intestine. Weakly expressed in testis, ovary, colon, pancreas, kidney and stomach. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MKTFTWTLGVLFFLLVDTGHCRGGQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDAST IKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNSLE LSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPN SQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPEN SNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIELEDWS DKKVYAEYSSFRLEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWWYNACAHSNL NGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQMMIKPID | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: ANGPTL1  Malacards: ANGPTL1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||