• Gene id: 90580

Gene Summary

• Gene Symbol: TIMM29   Gene   UCSC   Ensembl
• Aliases: C19orf52, TIM29
• Gene name: translocase of inner mitochondrial membrane 29
• Alternate names: mitochondrial import inner membrane translocase subunit Tim29, uncharacterized protein C19orf52,
• Gene location: 19p13.2 (10928810: 10930253)     Exons: 2     NC_000019.10
• OMIM: 616386

Protein Summary

• Protein general information: Q9BSF4  
  • Name: Mitochondrial import inner membrane translocase subunit Tim29 (TIM29)
  • Length: 260  
  • Mass: 29233
• Sequence:

  MAAAALRRFWSRRRAEAGDAVVAKPGVWARLGSWARALLRDYAEACRDASAEARARPGRAAVYVGLLGGAAACFT
  LAPSEGAFEEALLEASGTLLLLAPATRNRESEAFVQRLLWLRGRGRLRYVNLGLCSLVYEAPFDAQASLYQARCR
  YLQPRWTDFPGRVLDVGFVGRWWVLGAWMRDCDINDDEFLHLPAHLRVVGPQQLHSETNERLFDEKYKPVVLTDD
  QVDQALWEEQVLQKEKKDRLALSQAHSLVQAEAPR

• Structural information:
  • Interpro: IPR019322  
  • STRING: ENSP00000270502
• Other Databases: GeneCards:  TIMM29  Malacards:  TIMM29

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042721	TIM22 mitochondrial import inner membrane insertion complex	IBA	cellular component
GO:0045039	protein insertion into mitochondrial inner membrane	IBA	biological process
GO:0042721	TIM22 mitochondrial import inner membrane insertion complex	IDA	cellular component
GO:0042721	TIM22 mitochondrial import inner membrane insertion complex	IDA	cellular component
GO:0042721	TIM22 mitochondrial import inner membrane insertion complex	IDA	cellular component
GO:0042721	TIM22 mitochondrial import inner membrane insertion complex	IDA	cellular component
GO:0005758	mitochondrial intermembrane space	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0045039	protein insertion into mitochondrial inner membrane	IDA	biological process
GO:0045039	protein insertion into mitochondrial inner membrane	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042721	TIM22 mitochondrial import inner membrane insertion complex	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881