• Gene id: 9058

Gene Summary

• Gene Symbol: SLC13A2   Gene   UCSC   Ensembl
• Aliases: NADC1, NaCT, NaDC-1, SDCT1
• Gene name: solute carrier family 13 member 2
• Alternate names: solute carrier family 13 member 2, Na(+)-coupled citrate transporter, Na(+)/dicarboxylate cotransporter 1, renal sodium/dicarboxylate cotransporter, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2,
• Gene location: 17q11.2 (28473356: 28497780)     Exons: 14     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a sodium-coupled citrate transporter that is regulated by the chaperone activity of cyclophilin b. The encoded protein may play a role in the formation of kidney stones. [provided by RefSeq, Oct 2016]
• OMIM: 604148

Protein Summary

• Protein general information: Q13183  
  • Name: Solute carrier family 13 member 2 (Na(+)/dicarboxylate cotransporter 1) (NaDC 1) (Renal sodium/dicarboxylate cotransporter)
  • Length: 592  
  • Mass: 64410
• Sequence:

  MATCWQALWAYRSYLIVFFVPILLLPLPILVPSKEAYCAYAIILMALFWCTEALPLAVTALFPLILFPMMGIVDA
  SEVAVEYLKDSNLLFFGGLLVAIAVEHWNLHKRIALRVLLIVGVRPAPLILGFMLVTAFLSMWISNTATSAMMVP
  IAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQCMSLCV
  CYSASIGGIATLTGTAPNLVLQGQINSLFPQNGNVVNFASWFSFAFPTMVILLLLAWLWLQILFLGFNFRKNFGI
  GEKMQEQQQAAYCVIQTEHRLLGPMTFAEKAISILFVILVLLWFTREPGFFLGWGNLAFPNAKGESMVSDGTVAI
  FIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLDWKTVNQKMPWNIVLLLGGGYALAKGSERSGLSEWLGNKLTP
  LQSVPAPAIAIILSLLVATFTECTSNVATTTIFLPILASMAQAICLHPLYVMLPCTLATSLAFMLPVATPPNAIV
  FSFGDLKVLDMARAGFLLNIIGVLIIALAINSWGIPLFSLHSFPSWAQSNTTAQCLPSLANTTTPSP

• Structural information:
  • Interpro: IPR031312  IPR001898  
  • Prosite: PS01271
  • STRING: ENSP00000392411
• Other Databases: GeneCards:  SLC13A2  Malacards:  SLC13A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015141	succinate transmembrane transporter activity	IDA	molecular function
GO:0071422	succinate transmembrane transport	IDA	biological process
GO:0098656	anion transmembrane transport	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0015293	symporter activity	IEA	molecular function
GO:0015361	low-affinity sodium:dicarboxylate symporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015361	low-affinity sodium:dicarboxylate symporter activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq