• Gene id: 90527

Gene Summary

• Gene Symbol: DUOXA1   Gene   UCSC   Ensembl
• Aliases: NIP, NUMBIP, mol
• Gene name: dual oxidase maturation factor 1
• Alternate names: dual oxidase maturation factor 1, dual oxidase activator 1, dual oxidase maturation factor 1 alpha, dual oxidase maturation factor 1 beta, dual oxidase maturation factor 1 delta, dual oxidase maturation factor 1 gamma, homolog of Drosophila Numb-interacting pro,
• Gene location: 15q21.1 (45129937: 45117365)     Exons: 12     NC_000015.10
• Gene summary(Entrez): Dual oxidases DUOX1 and DUOX2 are NADPH oxidases which are involved in hydrogen peroxide production necessary for thyroid hormonogenesis. They form a heterodimer with specific maturation factors DUOXA1 and DUOXA2, respectively, which is essential for the

Protein Summary

• Protein general information: Q1HG43  
  • Name: Dual oxidase maturation factor 1 (Dual oxidase activator 1) (Numb interacting protein)
  • Length: 343  
  • Mass: 37815
  • Tissue specificity: Specifically expressed in thyroid gland. Also detected in esophagus. {ECO
• Sequence:

  MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTSLFIGAAILAVNFSSE
  WSVGQVSTNTSYKAFSSEWISADIGLQVGLGGVNITLTGTPVQQLNETINYNEEFTWRLGENYAEEYAKALEKGL
  PDPVLYLAEKFTPRSPCGLYRQYRLAGHYTSAMLWVAFLCWLLANVMLSMPVLVYGGYMLLATGIFQLLALLFFS
  MATSLTSPCPLHLGASVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEG
  GLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL

• Structural information:
  • Interpro: IPR018469  
  • STRING: ENSP00000267803
• Other Databases: GeneCards:  DUOXA1  Malacards:  DUOXA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0042743	hydrogen peroxide metabolic process	IEA	biological process
GO:2000609	regulation of thyroid hormone generation	IEA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0034613	cellular protein localization	IGI	biological process
GO:0010729	positive regulation of hydrogen peroxide biosynthetic process	IMP	biological process
GO:0008104	protein localization	IGI	biological process
GO:0008104	protein localization	IGI	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881