• Gene id: 9046

Gene Summary

• Gene Symbol: DOK2   Gene   UCSC   Ensembl
• Aliases: p56DOK, p56dok-2
• Gene name: docking protein 2
• Alternate names: docking protein 2, docking protein 2, 56kD, docking protein 2, 56kDa, downstream of tyrosine kinase 2, p56(dok-2),
• Gene location: 8p21.3 (21913716: 21908872)     Exons: 5     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210(bcr/abl), a chimeric protein wh
• OMIM: 609550

Protein Summary

• Protein general information: O60496  
  • Name: Docking protein 2 (Downstream of tyrosine kinase 2) (p56(dok 2))
  • Length: 412  
  • Mass: 45379
  • Tissue specificity: Highly expressed in peripheral blood leukocytes, lymph nodes and spleen. Lower expression in thymus, bone marrow and fetal liver. {ECO
• Sequence:

  MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVIRLSDCLRVAEAGGEA
  SSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFPGQRKELSGPEGKQSRPCMEENELYSSAVTVGPHKE
  FAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFE
  FETRQGNEIFLALEEAISAQKNAAPATPQPQPATIPASLPRPDSPYSRPHDSLPPPSPTTPVPAPRPRGQEGEYA
  VPFDAVARSLGKNFRGILAVPPQLLADPLYDSIEETLPPRPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATAD
  RDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK

• Structural information:
  • Protein Domains: (4..11-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (147..25-)
    (/note="IRS-type-PTB)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00389"-)
  • Interpro: IPR037751  IPR002404  IPR011993  IPR001849  
  • Prosite: PS51064 PS50003
  • CDD: cd01203
  • PDB: 2D9W 2DLW
  • PDBsum: 2D9W 2DLW
  • STRING: ENSP00000276420
• Other Databases: GeneCards:  DOK2  Malacards:  DOK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016032	viral process	IEA	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007265	Ras protein signal transduction	IEA	biological process
GO:0005068	transmembrane receptor protein tyrosine kinase adaptor activity	IEA	molecular function
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq