• Gene id: 9038

Gene Summary

• Gene Symbol: TAAR5   Gene   UCSC   Ensembl
• Aliases: PNR
• Gene name: trace amine associated receptor 5
• Alternate names: trace amine-associated receptor 5, hTaar5, putative neurotransmitter receptor, taR-5, trace amine receptor 5,
• Gene location: 6q23.2 (132589737: 132588591)     Exons: 1     NC_000006.12
• OMIM: 600340

Protein Summary

• Protein general information: O14804  
  • Name: Trace amine associated receptor 5 (TaR 5) (Trace amine receptor 5) (hTaar5) (Putative neurotransmitter receptor)
  • Length: 337  
  • Mass: 38242
  • Tissue specificity: Expressed almost exclusively in skeletal muscle and selected areas of the brain, such amygdala, hippocampus, caudate nucleus, thalamus and hypothalamus. Weak expression is also find in substantia nigra. {ECO
• Sequence:

  MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVSYFKALHTPTNFLLLS
  LALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRV
  ALRYILAGWGVPAAYTSLFLYTDVVETRLSQWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVV
  ATRQAQQITTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSAC
  NPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR009132  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000258034
• Other Databases: GeneCards:  TAAR5  Malacards:  TAAR5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001594	trace-amine receptor activity	IBA	molecular function
GO:1990081	trimethylamine receptor activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0001594	trace-amine receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:1990081	trimethylamine receptor activity	IEA	molecular function
GO:0007606	sensory perception of chemical stimulus	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray