• Gene id: 90379

Gene Summary

• Gene Symbol: DCAF15   Gene   UCSC   Ensembl
• Aliases: C19orf72
• Gene name: DDB1 and CUL4 associated factor 15
• Alternate names: DDB1- and CUL4-associated factor 15,
• Gene location: 19p13.12 (13952473: 13961448)     Exons: 13     NC_000019.10

Protein Summary

• Protein general information: Q66K64  
  • Name: DDB1 and CUL4 associated factor 15
  • Length: 600  
  • Mass: 66463
• Sequence:

  MAPSSKSERNSGAGSGGGGPGGAGGKRAAGRRREHVLKQLERVKISGQLSPRLFRKLPPRVCVSLKNIVDEDFLY
  AGHIFLGFSKCGRYVLSYTSSSGDDDFSFYIYHLYWWEFNVHSKLKLVRQVRLFQDEEIYSDLYLTVCEWPSDAS
  KVIVFGFNTRSANGMLMNMMMMSDENHRDIYVSTVAVPPPGRCAACQDASRAHPGDPNAQCLRHGFMLHTKYQVV
  YPFPTFQPAFQLKKDQVVLLNTSYSLVACAVSVHSAGDRSFCQILYDHSTCPLAPASPPEPQSPELPPALPSFCP
  EAAPARSSGSPEPSPAIAKAKEFVADIFRRAKEAKGGVPEEARPALCPGPSGSRCRAHSEPLALCGETAPRDSPP
  ASEAPASEPGYVNYTKLYYVLESGEGTEPEDELEDDKISLPFVVTDLRGRNLRPMRERTAVQGQYLTVEQLTLDF
  EYVINEVIRHDATWGHQFCSFSDYDIVILEVCPETNQVLINIGLLLLAFPSPTEEGQLRPKTYHTSLKVAWDLNT
  GIFETVSVGDLTEVKGQTSGSVWSSYRKSCVDMVMKWLVPESSGRYVNRMTNEALHKGCSLKVLADSERYTWIVL

• Structural information:
  • Interpro: IPR038914  IPR032734  
  • PDB: 6PAI 6Q0R 6Q0V 6Q0W 6SJ7 6UD7 6UE5
  • PDBsum: 6PAI 6Q0R 6Q0V 6Q0W 6SJ7 6UD7 6UE5
  • STRING: ENSP00000254337
• Other Databases: GeneCards:  DCAF15  Malacards:  DCAF15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IBA	cellular component
GO:0016567	protein ubiquitination	IBA	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0032814	regulation of natural killer cell activation	IMP	biological process
GO:0008144	drug binding	IPI	molecular function
GO:0008144	drug binding	IPI	molecular function
GO:0008144	drug binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq