• Gene id: 90313

Gene Summary

• Gene Symbol: TP53I13   Gene   UCSC   Ensembl
• Aliases: DSCP1
• Gene name: tumor protein p53 inducible protein 13
• Alternate names: tumor protein p53-inducible protein 13, damage-stimulated cytoplasmic protein 1,
• Gene location: 17q11.2 (29567179: 29573156)     Exons: 9     NC_000017.11
• OMIM: 604657

Protein Summary

• Protein general information: Q8NBR0  
  • Name: Tumor protein p53 inducible protein 13 (Damage stimulated cytoplasmic protein 1)
  • Length: 393  
  • Mass: 42238
  • Tissue specificity: Expressed in heart, placenta, skeletal muscle, testis, brain and lung.
• Sequence:

  MAPPPPSPQLLLLAALARLLGPSEVMAGPAEEAGAHCPESLWPLPPQVSPRVTYTRVSPGQAEDVTFLYHPCAHP
  WLKLQLALLAYACMANPSLTPDFSLTQDRPLVLTAWGLALEMAWVEPAWAAHWLMRRRRRKQRKKKAWIYCESLS
  GPAPSEPTPGRGRLCRRGCVQALALAFALRSWRPPGTEVTSQGPRQPSSSGAKRRRLRAALGPQPTRSALRFPSA
  SPGSLKAKQSMAGIPGRESNAPSVPTVSLLPGAPGGNASSRTEAQVPNGQGSPGGCVCSSQASPAPRAAAPPRAA
  RGPTPRTEEAAWAAMALTFLLVLLTLATLCTRLHRNFRRGESIYWGPTADSQDTVAAVLKRRLLQPSRRVKRSRR
  RPLLPPTPDSGPEGESSE

• Structural information:
  • STRING: ENSP00000301057
• Other Databases: GeneCards:  TP53I13  Malacards:  TP53I13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045786	negative regulation of cell cycle	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0009411	response to UV	IEP	biological process
GO:0042493	response to drug	IEP	biological process
GO:0014070	response to organic cyclic compound	IEP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq