• Gene id: 9027

Gene Summary

• Gene Symbol: NAT8   Gene   UCSC   Ensembl
• Aliases: ATase2, CCNAT, CML1, GLA, Hcml1, TSC501, TSC510
• Gene name: N-acetyltransferase 8 (putative)
• Alternate names: N-acetyltransferase 8, N-acetyltransferase 8 (GCN5-related, putative), N-acetyltransferase 8 (camello like), acetyltransferase 2, camello-like protein 1, cysteinyl-conjugate N-acetyltransferase, kidney- and liver-specific gene product, probable N-acetyltransfera,
• Gene location: 2p13.1 (73642421: 73640722)     Exons: 2     NC_000002.12
• Gene summary(Entrez): This gene, isolated using the differential display method to detect tissue-specific genes, is specifically expressed in kidney and liver. The encoded protein shows amino acid sequence similarity to N-acetyltransferases. A similar protein in Xenopus affect
• OMIM: 602413

Protein Summary

• Protein general information: Q9UHE5  
  • Name: N acetyltransferase 8 (EC 2.3.1. ) (Acetyltransferase 2) (ATase2) (Camello like protein 1) (Cysteinyl conjugate N acetyltransferase) (CCNAT) (EC 2.3.1.80)
  • Length: 227  
  • Mass: 25619
  • Tissue specificity: Preferentially expressed in liver and kidney. Also detected in brain (at protein level). {ECO
• Sequence:

  MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSWLLALVFSISLFPALW
  FLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVDSEHRR
  QGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVG
  SL

• Structural information:
  • Protein Domains: (61..22-)
    (/note="N-acetyltransferase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00532"-)
  • Interpro: IPR016181  IPR000182  
  • Prosite: PS51186
  • STRING: ENSP00000272425
• Other Databases: GeneCards:  NAT8  Malacards:  NAT8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008080	N-acetyltransferase activity	IBA	molecular function
GO:0047198	cysteine-S-conjugate N-acetyltransferase activity	IDA	molecular function
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0018003	peptidyl-lysine N6-acetylation	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0018003	peptidyl-lysine N6-acetylation	IDA	biological process
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0006749	glutathione metabolic process	IDA	biological process
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IDA	cellular component
GO:0004468	lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	IDA	molecular function
GO:0004468	lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	IDA	molecular function
GO:0050435	amyloid-beta metabolic process	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008080	N-acetyltransferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0042493	response to drug	TAS	biological process
GO:0047198	cysteine-S-conjugate N-acetyltransferase activity	IEA	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0006749	glutathione metabolic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00480	Glutathione metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881