Search Result
| Gene id | 90199 | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | WFDC8 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||
| Aliases | C20orf170, HEL-S-292, WAP8, dJ461P17.1 | ||||||||||||||||||||||||||||||||||||||||||||
| Gene name | WAP four-disulfide core domain 8 | ||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | WAP four-disulfide core domain protein 8, WAP motif protein 1, epididymis secretory protein Li 292, epididymis secretory sperm binding protein, protease inhibitor WAP8, putative protease inhibitor WAP8, testicular secretory protein Li 68, | ||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
20q13.12 (45579304: 45551151) Exons: 7 NC_000020.11 |
||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. The enco |
||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q8IUA0 Name: WAP four disulfide core domain protein 8 (Putative protease inhibitor WAP8) Length: 241 Mass: 27824 Tissue specificity: Expressed ubiquitously, the highest levels are found in the epididymis followed by testis and trachea. | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MWTVRTEGGHFPLHSPTFSWRNVAFLLLLSLALEWTSAMLTKKIKHKPGLCPKERLTCTTELPDSCNTDFDCKEY QKCCFFACQKKCMDPFQEPCMLPVRHGNCNHEAQRWHFDFKNYRCTPFKYRGCEGNANNFLNEDACRTACMLIVK DGQCPLFPFTERKECPPSCHSDIDCPQTDKCCESRCGFVCARAWTVKKGFCPRKPLLCTKIDKPKCLQDEECPLV EKCCSHCGLKCMDPRR | ||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: WFDC8  Malacards: WFDC8 | ||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||