• Gene id: 9019

Gene Summary

• Gene Symbol: MPZL1   Gene   UCSC   Ensembl
• Aliases: MPZL1b, PZR, PZR1b, PZRa, PZRb
• Gene name: myelin protein zero like 1
• Alternate names: myelin protein zero-like protein 1, immunoglobulin family transmembrane protein, protein zero related,
• Gene location: 1q24.2 (167721981: 167791918)     Exons: 6     NC_000001.11

Protein Summary

• Protein general information: O95297  
  • Name: Myelin protein zero like protein 1 (Protein zero related)
  • Length: 269  
  • Mass: 29082
  • Tissue specificity: Widely expressed with highest levels in heart, placenta, kidney and pancreas. Isoform 3 is relatively abundant in hematopoietic tissues and fetal liver. Isoform 1 and isoform 3 are expressed in CD14- PB monocytes and pre-B cell progeni
• Sequence:

  MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWS
  FQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHI
  RLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEG
  LVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN

• Structural information:
  • Protein Domains: (36..14-)
    (/note="Ig-like-V-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106   IPR029870  IPR000920  
  • Prosite: PS50835
  • PDB: 6IGO 6IGT 6IGW
  • PDBsum: 6IGO 6IGT 6IGW
  • STRING: ENSP00000352513
• Other Databases: GeneCards:  MPZL1  Malacards:  MPZL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005198	structural molecule activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0009986	cell surface	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray