• Gene id: 90139

Gene Summary

• Gene Symbol: TSPAN18   Gene   UCSC   Ensembl
• Aliases: TSPAN
• Gene name: tetraspanin 18
• Alternate names: tetraspanin-18, tspan-18,
• Gene location: 11p11.2 (44726961: 44932422)     Exons: 12     NC_000011.10

Protein Summary

• Protein general information: Q96SJ8  
  • Name: Tetraspanin 18 (Tspan 18)
  • Length: 248  
  • Mass: 27710
• Sequence:

  MEGDCLSCMKYLMFVFNFFIFLGGACLLAIGIWVMVDPTGFREIVAANPLLLTGAYILLAMGGLLFLLGFLGCCG
  AVRENKCLLLFFFLFILIIFLAELSAAILAFIFRENLTREFFTKELTKHYQGNNDTDVFSATWNSVMITFGCCGV
  NGPEDFKFASVFRLLTLDSEEVPEACCRREPQSRDGVLLSREECLLGRSLFLNKQGCYTVILNTFETYVYLAGAL
  AIGVLAIELFAMIFAMCLFRGIQ

• Structural information:
  • Interpro: IPR000301  IPR018499  IPR018503  IPR008952  
  • Prosite: PS00421
  • STRING: ENSP00000339820
• Other Databases: GeneCards:  TSPAN18  Malacards:  TSPAN18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq