• Gene id: 9002

Gene Summary

• Gene Symbol: F2RL3   Gene   UCSC   Ensembl
• Aliases: PAR4
• Gene name: F2R like thrombin or trypsin receptor 3
• Alternate names: proteinase-activated receptor 4, F2R like thrombin/trypsin receptor 3, PAR-4, coagulation factor II (thrombin) receptor-like 3, protease-activated receptor-4, thrombin receptor-like 3,
• Gene location: 19p13.11 (16888998: 16892605)     Exons: 2     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the protease-activated receptor subfamily, part of the G-protein coupled receptor 1 family of proteins. The encoded receptor is proteolytically processed to reveal an extracellular N-terminal tethered ligand that binds to and
• OMIM: 602779

Protein Summary

• Protein general information: Q96RI0  
  • Name: Proteinase activated receptor 4 (PAR 4) (Coagulation factor II receptor like 3) (Thrombin receptor like 3)
  • Length: 385  
  • Mass: 41133
  • Tissue specificity: Widely expressed, with highest levels in lung, pancreas, thyroid, testis and small intestine. Not expressed in brain, kidney, spinal cord and peripheral blood leukocytes. Also detected in platelets.
• Sequence:

  MWGRLLLWPLVLGFSLSGGTQTPSVYDESGSTGGGDDSTPSILPAPRGYPGQVCANDSDTLELPDSSRALLLGWV
  PTRLVPALYGLVLVVGLPANGLALWVLATQAPRLPSTMLLMNLAAADLLLALALPPRIAYHLRGQRWPFGEAACR
  LATAALYGHMYGSVLLLAAVSLDRYLALVHPLRARALRGRRLALGLCMAAWLMAAALALPLTLQRQTFRLARSDR
  VLCHDALPLDAQASHWQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGHALRLTAVVLASAVAFFVPSN
  LLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSPGDTVASKASAEGGSR
  GMGTHSSLLQ

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR003944  IPR003912  
  • Prosite: PS00237 PS50262
  • PDB: 2ZPK 3QDZ
  • PDBsum: 2ZPK 3QDZ
  • STRING: ENSP00000248076
• Other Databases: GeneCards:  F2RL3  Malacards:  F2RL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IBA	biological process
GO:0035025	positive regulation of Rho protein signal transduction	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0007596	blood coagulation	IEA	biological process
GO:0015057	thrombin-activated receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0070493	thrombin-activated receptor signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007599	hemostasis	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0015057	thrombin-activated receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0009611	response to wounding	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0060155	platelet dense granule organization	IC	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04080	Neuroactive ligand-receptor interaction
hsa04015	Rap1 signaling pathway
hsa04611	Platelet activation
hsa04610	Complement and coagulation cascades

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq