• Gene id: 8942

Gene Summary

• Gene Symbol: KYNU   Gene   UCSC   Ensembl
• Aliases: KYNUU, VCRL2
• Gene name: kynureninase
• Alternate names: kynureninase, L-kynurenine hydrolase,
• Gene location: 2q22.2 (142877663: 143055832)     Exons: 21     NC_000002.12
• Gene summary(Entrez): Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NA
• OMIM: 605197

Protein Summary

• Protein general information: Q16719  
  • Name: Kynureninase (EC 3.7.1.3) (L kynurenine hydrolase)
  • Length: 465  
  • Mass: 52352
  • Tissue specificity: Expressed in all tissues tested (heart, brain placenta, lung, liver, skeletal muscle, kidney and pancreas). Highest levels found in placenta, liver and lung. Expressed in all brain regions. {ECO
• Sequence:

  MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIYFLGNS
  LGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVNLHLLMLSFFK
  PTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEKEGDSIAVILFSGVHF
  YTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP
  ALVGWFGHELSTRFKMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFKQATMKALRKKSVLLTGYLEYLIKHN
  YGKDKAATKKPVVNIITPSHVEERGCQLTITFSVPNKDVFQELEKRGVVCDKRNPNGIRVAPVPLYNSFHDVYKF
  TNLLTSILDSAETKN

• Structural information:
  • Interpro: IPR000192  IPR010111  IPR015424  IPR015422  IPR015421  
  • PDB: 2HZP 3E9K
  • PDBsum: 2HZP 3E9K
  • STRING: ENSP00000264170
• Other Databases: GeneCards:  KYNU  Malacards:  KYNU

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019441	tryptophan catabolic process to kynurenine	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0030429	kynureninase activity	IBA	molecular function
GO:0043420	anthranilate metabolic process	IBA	biological process
GO:0061981	3-hydroxykynureninase activity	IDA	molecular function
GO:0009435	NAD biosynthetic process	IMP	biological process
GO:0006569	tryptophan catabolic process	IEA	biological process
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0009435	NAD biosynthetic process	IEA	biological process
GO:0030429	kynureninase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0019363	pyridine nucleotide biosynthetic process	IEA	biological process
GO:0030429	kynureninase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006569	tryptophan catabolic process	TAS	biological process
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0019442	tryptophan catabolic process to acetyl-CoA	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0030429	kynureninase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0034354	'de novo' NAD biosynthetic process from tryptophan	IEA	biological process
GO:0006569	tryptophan catabolic process	IEA	biological process
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0019805	quinolinate biosynthetic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0030429	kynureninase activity	IEA	molecular function
GO:0043420	anthranilate metabolic process	IEA	biological process
GO:0097053	L-kynurenine catabolic process	IEA	biological process
GO:0009435	NAD biosynthetic process	IEA	biological process
GO:0034341	response to interferon-gamma	IDA	biological process
GO:0030429	kynureninase activity	IDA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0019805	quinolinate biosynthetic process	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0043420	anthranilate metabolic process	IDA	biological process
GO:0030429	kynureninase activity	IDA	molecular function
GO:0006569	tryptophan catabolic process	IMP	biological process
GO:0034516	response to vitamin B6	IMP	biological process
GO:0030429	kynureninase activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00380	Tryptophan metabolism

Diseases

Associated diseases	References
Vertebral, cardiac, renal, and limb defects syndrome	KEGG:H02087
Hydroxykynureninuria	KEGG:H01583
Vertebral, cardiac, renal, and limb defects syndrome	KEGG:H02087
Hydroxykynureninuria	KEGG:H01583
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray