• Gene id: 8938

Gene Summary

• Gene Symbol: BAIAP3   Gene   UCSC   Ensembl
• Aliases: BAP3
• Gene name: BAI1 associated protein 3
• Alternate names: BAI1-associated protein 3, BAI-associated protein 3, brain-specific angiogenesis inhibitor I-associated protein 3,
• Gene location: 16p13.3 (1333644: 1349440)     Exons: 36     NC_000016.10
• Gene summary(Entrez): This p53-target gene encodes a brain-specific angiogenesis inhibitor. The protein is a seven-span transmembrane protein and a member of the secretin receptor family. It interacts with the cytoplasmic region of brain-specific angiogenesis inhibitor 1. This
• OMIM: 613859

Protein Summary

• Protein general information: O94812  
  • Name: BAI1 associated protein 3 (BAP3) (Brain specific angiogenesis inhibitor I associated protein 3)
  • Length: 1187  
  • Mass: 131901
  • Tissue specificity: Predominantly expressed in brain (PubMed
• Sequence:

  MRPRGAAFAAGPPGDLHLGTAIGFAGAIWRSRSPAMSTLLDIKSSVLRQVQVCPSFRRRTEQDPGSASADPQEPA
  TGAWKPGDGVEFFAHMRLMLKKGEGRQGLPCLEVPLRSGSPAPPEPVDPSLGLRALAPEEVEMLYEEALYTVLYR
  AGTMGPDQVDDEEALLSYLQQVFGTSLEEHTEAIERVRKAKAPTYALKVSVMRAKNLLAKDPNGFSDPYCMLGIL
  PASDATREPRAQKEQRFGFRKGSKRGGPLPAKCIQVTEVKSSTLNPVWKEHFLFEIEDVSTDQLHLDIWDHDDDV
  SLVEACRKLNEVIGLKGMGRYFKQIVKSARANGTAGPTEDHTDDFLGCLNIPVREVPVAGVDRWFKLEPRSSASR
  VQGHCHLVLKLITTQRDTAMSQRGRSGFLSHLLLLSHLLRLEHSAEEPNSSSWRGELSTPAATILCLHGAQSNLS
  PLQLAVLHWQVSSRHHQTCTLDYSYLLGLLEDMQAHWEEAPSLPQEQEESLADSLSAFSEFGLQLLRQLRDYFPA
  TNSTAVHRLELLLKCLGKLQLFQPSFEICPFESELNMDIAAALKRGNREWYDRILNDKSPREQPGPQRLPGLVVL
  ADAVYDDLQFCYSVYASLFHSILNVDVFTLTFRQLERLVAEEAWVLTEELSPKMTLEVASGLFELYLTLADLQRF
  WDSIPGRDSRSLALAGIHAPFLPAVKLWFQVLRDQAKWRLQGAVDMDTLEPVDASSRHSSSAATAGLCLSHIQEL
  WVRLAWPDPAQAQGLGTQLGQDVCEATLFYTELLRKKVDTQPGAAGEAVSEALCVVLNNVELVRKAAGQALKGLA
  WPEGATGPEGVLPRPLLSCTQALDDDLQREAHTVTAHLTSKMVGDIRKYVQHISLSPDSIQNDEAVAPLMKYLDE
  KLALLNASLVKGNLSRVLEALWELLLQAILQALGANRDVSADFYSRFHFTLEALVSFFHAEGQGLPLESLRDGSY
  KRLKEELRLHKCSTRECIEQFYLDKLKQRTLEQNRFGRLSVRCHYEAAEQRLAVEVLHAADLLPLDANGLSDPFV
  IVELGPPHLFPLVRSQRTQVKTRTLHPVYDELFYFSVPAEACRRRAACVLFTVMDHDWLSTNDFAGEAALGLGGV
  TGVARPQVGGGARAGQPVTLHLCRPRAQVRSALRRLEGRTSKEAQEFVKKLKELEKCMEADP

• Structural information:
  • Protein Domains: (176..33-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (663..78-)
    (/note="MHD1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00587-)
    (888..99-)
    (/note="MHD2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00588-)
    (-)
  • Interpro: IPR000008  IPR035892  IPR014770  IPR014772  
  • Prosite: PS50004 PS51258 PS51259
  • STRING: ENSP00000324510
• Other Databases: GeneCards:  BAIAP3  Malacards:  BAIAP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IPI	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0031045	dense core granule	IDA	NOT|cellular component
GO:0031901	early endosome membrane	IDA	NOT|cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0031902	late endosome membrane	IDA	cellular component
GO:0032588	trans-Golgi network membrane	IDA	cellular component
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000149	SNARE binding	IDA	molecular function
GO:0005543	phospholipid binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:1905413	regulation of dense core granule exocytosis	IDA	biological process
GO:0042147	retrograde transport, endosome to Golgi	IDA	biological process
GO:1990502	dense core granule maturation	IMP	biological process
GO:0032228	regulation of synaptic transmission, GABAergic	ISS	biological process
GO:0001956	positive regulation of neurotransmitter secretion	IMP	biological process
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019905	syntaxin binding	IPI	molecular function
GO:0019905	syntaxin binding	IPI	molecular function
GO:0000149	SNARE binding	IPI	molecular function
GO:0000149	SNARE binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq