|
Gene id |
8926 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
SNURF Gene UCSC Ensembl |
|
Gene name |
SNRPN upstream reading frame |
|
Alternate names |
SNRPN upstream reading frame protein, |
|
Gene location |
15q11.2 (24954892: 24978722) Exons: 2 NC_000015.10
|
|
Gene summary(Entrez) |
This gene is located within the Prader-Willi Syndrome critical region on chromosome 15. Transcripts produced from this gene initiate at an imprinting center and are paternally-imprinted. These transcripts may be bicistronic and also encode SNRPN (small nu
|
Protein Summary
|
| Protein general information
| Q9Y675
Name: SNRPN upstream reading frame protein
Length: 71 Mass: 8412
Tissue specificity: Expressed in heart, skeletal muscle and lymphoblasts (at protein level). Expressed in brain, pancreas, heart, liver, lung, kidney and skeletal muscle. {ECO
|
| Sequence |
MERARDRLHLRRTTEQHVPEVEVQVKRRRTASLSNQECQLYPRRSQQQQVPVVDFQAELRQAFLAETPRGG
|
| Structural information |
|
| Other Databases |
GeneCards: SNURF  Malacards: SNURF |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0016607 |
nuclear speck
|
IBA |
cellular component |
GO:0005634 |
nucleus
|
IEA |
cellular component |
GO:0005634 |
nucleus
|
IEA |
cellular component |
GO:0016607 |
nuclear speck
|
IDA |
cellular component |
GO:0005634 |
nucleus
|
NAS |
cellular component |
GO:0003674 |
molecular_function
|
ND |
molecular function |
GO:0008150 |
biological_process
|
ND |
biological process |
|
|
| Associated diseases |
References |
| Cryptorchidism | MIK: 21412036 |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 21412036 |
Cryptorchi dism
|
|
|
23 (4 controls, 19 cases)
|
Male infertility |
GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
|