• Gene id: 89122

Gene Summary

• Gene Symbol: TRIM4   Gene   UCSC   Ensembl
• Aliases: RNF87
• Gene name: tripartite motif containing 4
• Alternate names: E3 ubiquitin-protein ligase TRIM4, RING finger protein 87, RING-type E3 ubiquitin transferase TRIM4, tripartite motif protein 4,
• Gene location: 7q22.1 (76141244: 76136332)     Exons: 3     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its f

Protein Summary

• Protein general information: Q9C037  
  • Name: E3 ubiquitin protein ligase TRIM4 (EC 2.3.2.27) (RING finger protein 87) (RING type E3 ubiquitin transferase TRIM4) (Tripartite motif containing protein 4)
  • Length: 500  
  • Mass: 57461
• Sequence:

  MEAEDIQEELTCPICLDYFQDPVSIECGHNFCRGCLHRNWAPGGGPFPCPECRHPSAPAALRPNWALARLTEKTQ
  RRRLGPVPPGLCGRHWEPLRLFCEDDQRPVCLVCRESQEHQTHAMAPIDEAFESYRTGNFDIHVDEWKRRLIRLL
  LYHFKQEEKLLKSQRNLVAKMKKVMHLQDVEVKNATQWKDKIKSQRMRISTEFSKLHNFLVEEEDLFLQRLNKEE
  EETKKKLNENTLKLNQTIASLKKLILEVGEKSQAPTLELLQNPKEVLTRSEIQDVNYSLEAVKVKTVCQIPLMKE
  MLKRFQVAVNLAEDTAHPKLVFSQEGRYVKNTASASSWPVFSSAWNYFAGWRNPQKTAFVERFQHLPCVLGKNVF
  TSGKHYWEVESRDSLEVAVGVCREDVMGITDRSKMSPDVGIWAIYWSAAGYWPLIGFPGTPTQQEPALHRVGVYL
  DRGTGNVSFYSAVDGVHLHTFSCSSVSRLRPFFWLSPLASLVIPPVTDRK

• Structural information:
  • Protein Domains: (288..50-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR035829  IPR003877   IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS50119 PS00518 PS50089
  • CDD: cd00021 cd15809
  • STRING: ENSP00000348216
• Other Databases: GeneCards:  TRIM4  Malacards:  TRIM4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045087	innate immune response	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0016567	protein ubiquitination	IBA	biological process
GO:0016604	nuclear body	IBA	cellular component
GO:0051091	positive regulation of DNA-binding transcription factor activity	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881