• Gene id: 8895

Gene Summary

• Gene Symbol: CPNE3   Gene   UCSC   Ensembl
• Aliases: CPN3, PRO1071
• Gene name: copine 3
• Alternate names: copine-3, copine III,
• Gene location: 8q21.3 (86514421: 86561497)     Exons: 18     NC_000008.11
• Gene summary(Entrez): Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a protein which contains two type II C2 domains in the amino-terminus and an A domain-like sequence in the car
• OMIM: 604207

Protein Summary

• Protein general information: O75131  
  • Name: Copine 3 (Copine III)
  • Length: 537  
  • Mass: 60131
  • Tissue specificity: Expressed in breast and weakly in prostate and ovarian tissues (PubMed
• Sequence:

  MAAQCVTKVALNVSCANLLDKDIGSKSDPLCVLFLNTSGQQWYEVERTERIKNCLNPQFSKTFIIDYYFEVVQKL
  KFGVYDIDNKTIELSDDDFLGECECTLGQIVSSKKLTRPLVMKTGRPAGKGSITISAEEIKDNRVVLFEMEARKL
  DNKDLFGKSDPYLEFHKQTSDGNWLMVHRTEVVKNNLNPVWRPFKISLNSLCYGDMDKTIKVECYDYDNDGSHDL
  IGTFQTTMTKLKEASRSSPVEFECINEKKRQKKKSYKNSGVISVKQCEITVECTFLDYIMGGCQLNFTVGVDFTG
  SNGDPRSPDSLHYISPNGVNEYLTALWSVGLVIQDYDADKMFPAFGFGAQIPPQWQVSHEFPMNFNPSNPYCNGI
  QGIVEAYRSCLPQIKLYGPTNFSPIINHVARFAAAATQQQTASQYFVLLIITDGVITDLDETRQAIVNASRLPMS
  IIIVGVGGADFSAMEFLDGDGGSLRSPLGEVAIRDIVQFVPFRQFQNAPKEALAQCVLAEIPQQVVGYFNTYKLL
  PPKNPATKQQKQ

• Structural information:
  • Protein Domains: (1..11-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (124..24-)
    (/note="C2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (291..51-)
    (/note="VWFA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00219"-)
  • Interpro: IPR000008  IPR035892  IPR037768  IPR010734  IPR002035   IPR036465  
  • Prosite: PS50004
  • CDD: cd04047 cd01459
  • STRING: ENSP00000477590
• Other Databases: GeneCards:  CPNE3  Malacards:  CPNE3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071277	cellular response to calcium ion	IBA	biological process
GO:0038128	ERBB2 signaling pathway	IBA	biological process
GO:0005544	calcium-dependent phospholipid binding	IBA	molecular function
GO:0030971	receptor tyrosine kinase binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0038128	ERBB2 signaling pathway	IDA	biological process
GO:0071363	cellular response to growth factor stimulus	IDA	biological process
GO:0030054	cell junction	IDA	cellular component
GO:0005544	calcium-dependent phospholipid binding	IDA	molecular function
GO:0071277	cellular response to calcium ion	IDA	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0048306	calcium-dependent protein binding	IDA	molecular function
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0046474	glycerophospholipid biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005925	focal adhesion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005544	calcium-dependent phospholipid binding	IDA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0071277	cellular response to calcium ion	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005737	cytoplasm	NAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005544	calcium-dependent phospholipid binding	TAS	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)