• Gene id: 886

Gene Summary

• Gene Symbol: CCKAR   Gene   UCSC   Ensembl
• Aliases: CCK-A, CCK1-R, CCK1R, CCKRA
• Gene name: cholecystokinin A receptor
• Alternate names: cholecystokinin receptor type A, CCK-A receptor, CCK-AR, cholecystokinin type-A receptor, cholecystokinin-1 receptor,
• Gene location: 4p15.2 (131125697: 131283533)     Exons: 24     NC_000006.12
• Gene summary(Entrez): This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallb
• OMIM: 118444

Protein Summary

• Protein general information: P32238  
  • Name: Cholecystokinin receptor type A (CCK A receptor) (CCK AR) (Cholecystokinin 1 receptor) (CCK1 R)
  • Length: 428  
  • Mass: 47841
• Sequence:

  MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTV
  TNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSR
  VWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVM
  MVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS
  SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNK
  RFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSHMSASVPPQ

• Structural information:
  • Interpro: IPR009126  IPR000596  IPR015276  IPR036472  IPR000276   IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 1D6G 1HZN 1PB2
  • PDBsum: 1D6G 1HZN 1PB2
  • STRING: ENSP00000295589
• Other Databases: GeneCards:  CCKAR  Malacards:  CCKAR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004951	cholecystokinin receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0032870	cellular response to hormone stimulus	IBA	biological process
GO:0042277	peptide binding	IBA	molecular function
GO:0046883	regulation of hormone secretion	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004951	cholecystokinin receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004951	cholecystokinin receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0001764	neuron migration	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0017046	peptide hormone binding	IPI	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0004951	cholecystokinin receptor activity	IDA	molecular function
GO:0038188	cholecystokinin signaling pathway	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway
hsa04972	Pancreatic secretion
hsa04911	Insulin secretion

Diseases

Associated diseases	References
Cholelithiasis	PMID:15908333
pancreatic cancer	PMID:10457335
pancreatic ductal carcinoma	PMID:12851875
pancreatic ductal carcinoma	PMID:9239407
obesity	PMID:9192855
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881