• Gene id: 8832

Gene Summary

• Gene Symbol: CD84   Gene   UCSC   Ensembl
• Aliases: LY9B, SLAMF5, hCD84, mCD84
• Gene name: CD84 molecule
• Alternate names: SLAM family member 5, CD84 antigen (leukocyte antigen), cell surface antigen MAX.3, hly9-beta, leucocyte differentiation antigen CD84, leukocyte antigen CD84, leukocyte differentiation antigen CD84, signaling lymphocytic activation molecule 5,
• Gene location: 1q23.3 (160579515: 160541093)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molec
• OMIM: 608750

Protein Summary

• Protein general information: Q9UIB8  
  • Name: SLAM family member 5 (Cell surface antigen MAX.3) (Hly9 beta) (Leukocyte differentiation antigen CD84) (Signaling lymphocytic activation molecule 5) (CD antigen CD84)
  • Length: 345  
  • Mass: 38782
  • Tissue specificity: Predominantly expressed in hematopoietic tissues, such as lymph node, spleen and peripheral leukocytes. Expressed in macrophages, B-cells, monocytes, platelets, thymocytes, T-cells and dendritic cells. Highly expressed in memory T-cell
• Sequence:

  MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVT
  VTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCN
  VTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTG
  LLSVLAMFFLLVLILSSVFLFRLFKRRQGRIFPEGSCLNTFTKNPYAASKKTIYTYIMASRNTQPAESRIYDEIL
  QSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI

• Structural information:
  • Protein Domains: (26..12-)
    (/note="Ig-like-V-type)
    (135..20-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  
  • Prosite: PS50835
  • PDB: 2PKD
  • PDBsum: 2PKD
  • DIP: 60957
  • STRING: ENSP00000312367
• Other Databases: GeneCards:  CD84  Malacards:  CD84

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033004	negative regulation of mast cell activation	IDA	biological process
GO:0032685	negative regulation of granulocyte macrophage colony-stimulating factor production	IDA	biological process
GO:0043305	negative regulation of mast cell degranulation	IDA	biological process
GO:0032701	negative regulation of interleukin-18 production	IDA	biological process
GO:2001256	regulation of store-operated calcium entry	IDA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	TAS	biological process
GO:0006952	defense response	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray