• Gene id: 8754

Gene Summary

• Gene Symbol: ADAM9   Gene   UCSC   Ensembl
• Aliases: CORD9, MCMP, MDC9, Mltng
• Gene name: ADAM metallopeptidase domain 9
• Alternate names: disintegrin and metalloproteinase domain-containing protein 9, ADAM metallopeptidase domain 9 (meltrin gamma), cellular disintegrin-related protein, cone rod dystrophy 9, metalloprotease/disintegrin/cysteine-rich protein 9, myeloma cell metalloproteinase,
• Gene location: 8p11.22 (38996766: 39105260)     Exons: 25     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes
• OMIM: 300171

Protein Summary

• Protein general information: Q13443  
  • Name: Disintegrin and metalloproteinase domain containing protein 9 (ADAM 9) (EC 3.4.24. ) (Cellular disintegrin related protein) (Meltrin gamma) (Metalloprotease/disintegrin/cysteine rich protein 9) (Myeloma cell metalloproteinase)
  • Length: 819  
  • Mass: 90556
  • Tissue specificity: Widely expressed. Expressed in chondrocytes. Isoform 2 is highly expressed in liver and heart. {ECO
• Sequence:

  MGSGARFPSGTLRVRWLLLLGLVGPVLGAARPGFQQTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVIQAEGK
  EHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFGLRGLLHLENASYGIE
  PLQNSSHFEHIIYRMDDVYKEPLKCGVSNKDIEKETAKDEEEEPPSMTQLLRRRRAVLPQTRYVELFIVVDKERY
  DMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDS
  AQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDGRDCSCGAKSCIMNSG
  ASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYSAPSCGNKLVDAGEECDCGTPKECELDPCCEGSTCKLK
  SFAECAYGDCCKDCRFLPGGTLCRGKTSECDVPEYCNGSSQFCQPDVFIQNGYPCQNNKAYCYNGMCQYYDAQCQ
  VIFGSKAKAAPKDCFIEVNSKGDRFGNCGFSGNEYKKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKC
  WGVDFQLGSDVPDPGMVNEGTKCGAGKICRNFQCVDASVLNYDCDVQKKCHGHGVCNSNKNCHCENGWAPPNCET
  KGYGGSVDSGPTYNEMNTALRDGLLVFFFLIVPLIVCAIFIFIKRDQLWRSYFRKKRSQTYESDGKNQANPSRQP
  GSVPRHVSPVTPPREVPIYANRFAVPTYAAKQPQQFPSRPPPPQPKVSSQGNLIPARPAPAPPLYSSLT

• Structural information:
  • Protein Domains: (212..40-)
    (/note="Peptidase-M12B)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00276-)
    (414..50-)
    (/note="Disintegrin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00068-)
    (644..69-)
    (/note="EGF-like-)
    (/evidence="ECO:0000255|PROSITE-ProR-)
  • Interpro: IPR006586  IPR018358  IPR001762  IPR036436  IPR013032   IPR000742  IPR024079  IPR001590  IPR002870  IPR034027  
  • Prosite: PS50215 PS00427 PS50214 PS01186 PS50026 PS00142
  • CDD: cd04269
  • PDB: 1M1V
  • PDBsum: 1M1V
  • STRING: ENSP00000419446
• Other Databases: GeneCards:  ADAM9  Malacards:  ADAM9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033627	cell adhesion mediated by integrin	ISS	biological process
GO:0016477	cell migration	ISS	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097327	response to antineoplastic agent	IEA	biological process
GO:0034616	response to laminar fluid shear stress	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0005080	protein kinase C binding	ISS	molecular function
GO:0017124	SH3 domain binding	ISS	molecular function
GO:0017124	SH3 domain binding	IPI	molecular function
GO:0017124	SH3 domain binding	IPI	molecular function
GO:0004222	metalloendopeptidase activity	IDA	molecular function
GO:0005178	integrin binding	IC	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0004222	metalloendopeptidase activity	IMP	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005518	collagen binding	IMP	molecular function
GO:0008237	metallopeptidase activity	IMP	molecular function
GO:0043236	laminin binding	IMP	molecular function
GO:0006509	membrane protein ectodomain proteolysis	IDA	biological process
GO:0007229	integrin-mediated signaling pathway	IC	biological process
GO:0034612	response to tumor necrosis factor	IDA	biological process
GO:0000186	activation of MAPKK activity	IDA	biological process
GO:0050714	positive regulation of protein secretion	IDA	biological process
GO:0005615	extracellular space	ISS	cellular component
GO:0006509	membrane protein ectodomain proteolysis	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0033627	cell adhesion mediated by integrin	IMP	biological process
GO:0033630	positive regulation of cell adhesion mediated by integrin	IMP	biological process
GO:0033631	cell-cell adhesion mediated by integrin	IEP	biological process
GO:0042117	monocyte activation	IMP	biological process
GO:0051384	response to glucocorticoid	ISS	biological process
GO:0051592	response to calcium ion	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:0007155	cell adhesion	IMP	biological process
GO:0007155	cell adhesion	IMP	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	ISS	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0009986	cell surface	ISS	cellular component
GO:0010042	response to manganese ion	IMP	biological process
GO:0030216	keratinocyte differentiation	IEP	biological process
GO:0031233	intrinsic component of external side of plasma membrane	ISS	cellular component
GO:0034241	positive regulation of macrophage fusion	IMP	biological process
GO:0042542	response to hydrogen peroxide	IMP	biological process
GO:0051044	positive regulation of membrane protein ectodomain proteolysis	ISS	biological process
GO:0051088	PMA-inducible membrane protein ectodomain proteolysis	TAS	biological process
GO:0051549	positive regulation of keratinocyte migration	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cone-rod dystrophy and cone dystrophy	KEGG:H00481
Cone-rod dystrophy and cone dystrophy	KEGG:H00481
pancreatic cancer	PMID:17465204
pancreatic ductal carcinoma	PMID:14997207
cervix uteri carcinoma in situ	PMID:19473694
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)