• Gene id: 8744

Gene Summary

• Gene Symbol: TNFSF9   Gene   UCSC   Ensembl
• Aliases: 4-1BB-L, CD137L, TNLG5A
• Gene name: TNF superfamily member 9
• Alternate names: tumor necrosis factor ligand superfamily member 9, 4-1BB ligand, 4-1BBL, homolog of mouse 4-1BB-L, receptor 4-1BB ligand, tumor necrosis factor (ligand) superfamily, member 9, tumor necrosis factor ligand 5A, tumor necrosis factor superfamily member 9,
• Gene location: 19p13.3 (6531025: 6535923)     Exons: 3     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molec
• OMIM: 602807

Protein Summary

• Protein general information: P41273  
  • Name: Tumor necrosis factor ligand superfamily member 9 (4 1BB ligand) (4 1BBL)
  • Length: 254  
  • Mass: 26625
  • Tissue specificity: Expressed in brain, placenta, lung, skeletal muscle and kidney.
• Sequence:

  MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPE
  LSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELR
  RVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHA
  WQLTQGATVLGLFRVTPEIPAGLPSPRSE

• Structural information:
  • Interpro: IPR021184  IPR006052  IPR042373  IPR008983  
  • Prosite: PS00251 PS50049
  • CDD: cd00184
  • PDB: 2X29 6A3V 6BWV 6CPR 6CU0 6D3N 6FIB 6MGE 6MGP
  • PDBsum: 2X29 6A3V 6BWV 6CPR 6CU0 6D3N 6FIB 6MGE 6MGP
  • DIP: 3020
  • STRING: ENSP00000245817
• Other Databases: GeneCards:  TNFSF9  Malacards:  TNFSF9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0032813	tumor necrosis factor receptor superfamily binding	IBA	molecular function
GO:0042104	positive regulation of activated T cell proliferation	IBA	biological process
GO:0045585	positive regulation of cytotoxic T cell differentiation	IBA	biological process
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0032813	tumor necrosis factor receptor superfamily binding	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0042129	regulation of T cell proliferation	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Multiple sclerosis	PMID:16970683
acute myeloid leukemia	PMID:11564827
colorectal cancer	PMID:16596186
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq