• Gene id: 874

Gene Summary

• Gene Symbol: CBR3   Gene   UCSC   Ensembl
• Aliases: HEL-S-25, SDR21C2, hCBR3
• Gene name: carbonyl reductase 3
• Alternate names: carbonyl reductase [NADPH] 3, NADPH-dependent carbonyl reductase 3, carbonyl reductase (NADPH) 3, epididymis secretory protein Li 25, short chain dehydrogenase/reductase family 21C member 2,
• Gene location: 21q22.12 (87220586: 87196159)     Exons: 6     NC_000007.14
• Gene summary(Entrez): Carbonyl reductase 3 catalyzes the reduction of a large number of biologically and pharmacologically active carbonyl compounds to their corresponding alcohols. The enzyme is classified as a monomeric NADPH-dependent oxidoreductase. CBR3 contains three e
• OMIM: 603608

Protein Summary

• Protein general information: O75828  
  • Name: Carbonyl reductase [NADPH] 3 (EC 1.1.1.184) (NADPH dependent carbonyl reductase 3) (Short chain dehydrogenase/reductase family 21C member 2)
  • Length: 277  
  • Mass: 30850
  • Tissue specificity: Detected in ovary, pancreas, intestine, colon, kidney, brain, thymus, lung, heart, liver, spleen, leukocyte, prostate and testis. {ECO
• Sequence:

  MSSCSRVALVTGANRGIGLAIARELCRQFSGDVVLTARDVARGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRD
  FLRKEYGGLNVLVNNAAVAFKSDDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENC
  SEDLQERFHSETLTEGDLVDLMKKFVEDTKNEVHEREGWPNSPYGVSKLGVTVLSRILARRLDEKRKADRILVNA
  CCPGPVKTDMDGKDSIRTVEEGAETPVYLALLPPDATEPQGQLVHDKVVQNW

• Structural information:
  • Interpro: IPR036291  IPR020904  IPR002347  
  • Prosite: PS00061
  • PDB: 2HRB
  • PDBsum: 2HRB
  • STRING: ENSP00000290354
• Other Databases: GeneCards:  CBR3  Malacards:  CBR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004090	carbonyl reductase (NADPH) activity	IBA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0004090	carbonyl reductase (NADPH) activity	IDA	molecular function
GO:0070402	NADPH binding	IDA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004090	carbonyl reductase (NADPH) activity	TAS	molecular function
GO:0004090	carbonyl reductase (NADPH) activity	IEA	molecular function
GO:0004090	carbonyl reductase (NADPH) activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042376	phylloquinone catabolic process	IEA	biological process
GO:0004090	carbonyl reductase (NADPH) activity	IEA	molecular function
GO:0000253	3-keto sterol reductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0050890	cognition	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00590	Arachidonic acid metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)