• Gene id: 8727

Gene Summary

• Gene Symbol: CTNNAL1   Gene   UCSC   Ensembl
• Aliases: ACRP, CLLP, alpha-CATU
• Gene name: catenin alpha like 1
• Alternate names: alpha-catulin, alpha-catenin-related protein, alpha2-catulin, catenin (cadherin-associated protein), alpha-like 1, catenin alpha-like protein 1,
• Gene location: 9q31.3 (109013534: 108942568)     Exons: 20     NC_000009.12
• OMIM: 604785

Protein Summary

• Protein general information: Q9UBT7  
  • Name: Alpha catulin (Alpha catenin related protein) (ACRP) (Catenin alpha like protein 1)
  • Length: 734  
  • Mass: 81896
  • Tissue specificity: Widely expressed. Expressed at lower level in neural tissues and at the highest level in the adrenal gland. {ECO
• Sequence:

  MAASPGPAGVGGAGAVYGSGSSGFALDSGLEIKTRSVEQTLLPLVSQITTLINHKDNTKKSDKTLQAIQRVGQAV
  NLAVGRFVKVGEAIANENWDLKEEINIACIEAKQAGETIAALTDITNLNHLESDGQITIFTDKTGVIKAARLLLS
  SVTKVLLLADRVVIKQIITSRNKVLATMERLEKVNSFQEFVQIFSQFGNEMVEFAHLSGDRQNDLKDEKKKAKMA
  AARAVLEKCTMMLLTASKTCLRHPNCESAHKNKEGVFDRMKVALDKVIEIVTDCKPNGETDISSISIFTGIKEFK
  MNIEALRENLYFQSKENLSVTLEVILERMEDFTDSAYTSHEHRERILELSTQARMELQQLISVWIQAQSKKTKSI
  AEELELSILKISHSLNELKKELHSTATQLAADLLKYHADHVVLKALKLTGVEGNLEALAEYACKLSEQKEQLVET
  CRLLRHISGTEPLEITCIHAEETFQVTGQQIISAAETLTLHPSSKIAKENLDVFCEAWESQISDMSTLLREINDV
  FEGRRGEKYGYLSLPKPMKNNANLKSLKPDKPDSEEQAKIAKLGLKLGLLTSDADCEIEKWEDQENEIVQYGRNM
  SSMAYSLYLFTRGEGPLKTSQDLIHQLEVFAAEGLKLTSSVQAFSKQLKDDDKLMLLLEINKLIPLCHQLQTVTK
  TSLQNKVFLKVDKCITKTRSMMALLVQLLSLCYKLLKKLQMENNGWVSVTNKDTMDSKT

• Structural information:
  • Interpro: IPR036723  IPR001033  IPR030045  IPR006077  
  • DIP: 33236
  • STRING: ENSP00000320434
• Other Databases: GeneCards:  CTNNAL1  Malacards:  CTNNAL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007266	Rho protein signal transduction	IEA	biological process
GO:0045296	cadherin binding	IEA	molecular function
GO:0051015	actin filament binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007266	Rho protein signal transduction	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881