• Gene id: 8685

Gene Summary

• Gene Symbol: MARCO   Gene   UCSC   Ensembl
• Aliases: SCARA2, SR-A6
• Gene name: macrophage receptor with collagenous structure
• Alternate names: macrophage receptor MARCO, scavenger receptor class A, member 2,
• Gene location: 2q14.2 (118942168: 118994663)     Exons: 18     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the class A scavenger receptor family and is part of the innate antimicrobial immune system. The protein may bind both Gram-negative and Gram-positive bacteria via an extracellular, C-terminal, scavenger rec
• OMIM: 604870

Protein Summary

• Protein general information: Q9UEW3  
  • Name: Macrophage receptor MARCO (Macrophage receptor with collagenous structure) (Scavenger receptor class A member 2)
  • Length: 520  
  • Mass: 52658
  • Tissue specificity: Expressed in alveolar macrophages (at protein level). Detected in macrophages from various tissues including thymus, kidney, Kupffer cells of liver, and spleen (PubMed
• Sequence:

  MRNKKILKEDELLSETQQAAFHQIAMEPFEINVPKPKRRNGVNFSLAVVVIYLILLTAGAGLLVVQVLNLQARLR
  VLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRVSHEHLLQRVDNFTQNPGMFRIKGEQ
  GAPGLQGHKGAMGMPGAPGPPGPPAEKGAKGAMGRDGATGPSGPQGPPGVKGEAGLQGPQGAPGKQGATGTPGPQ
  GEKGSKGDGGLIGPKGETGTKGEKGDLGLPGSKGDRGMKGDAGVMGPPGAQGSKGDFGRPGPPGLAGFPGAKGDQ
  GQPGLQGVPGPPGAVGHPGAKGEPGSAGSPGRAGLPGSPGSPGATGLKGSKGDTGLQGQQGRKGESGVPGPAGVK
  GEQGSPGLAGPKGAPGQAGQKGDQGVKGSSGEQGVKGEKGERGENSVSVRIVGSSNRGRAEVYYSGTWGTICDDE
  WQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV

• Structural information:
  • Protein Domains: (147..41-)
    (/note="Collagen-like-)
    (424..51-)
    (/note="SRCR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196"-)
  • Interpro: IPR008160  IPR001190  IPR017448  IPR036772  
  • Prosite: PS00420 PS50287
  • STRING: ENSP00000318916
• Other Databases: GeneCards:  MARCO  Malacards:  MARCO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001540	amyloid-beta binding	ISS	molecular function
GO:0001664	G protein-coupled receptor binding	ISS	molecular function
GO:0001664	G protein-coupled receptor binding	IPI	molecular function
GO:0038024	cargo receptor activity	ISS	molecular function
GO:0006898	receptor-mediated endocytosis	ISS	biological process
GO:0006911	phagocytosis, engulfment	ISS	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0097242	amyloid-beta clearance	ISS	biological process
GO:0001664	G protein-coupled receptor binding	IBA	molecular function
GO:0005592	collagen type XI trimer	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0006897	endocytosis	IBA	biological process
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005581	collagen trimer	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0038187	pattern recognition receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0038024	cargo receptor activity	IEA	molecular function
GO:0001664	G protein-coupled receptor binding	IEA	molecular function
GO:0043277	apoptotic cell clearance	IEA	biological process
GO:0006897	endocytosis	IEA	biological process
GO:0097242	amyloid-beta clearance	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA	biological process
GO:0006911	phagocytosis, engulfment	IEA	biological process
GO:0006898	receptor-mediated endocytosis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0001540	amyloid-beta binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04145	Phagosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881