• Gene id: 8677

Gene Summary

• Gene Symbol: STX10   Gene   UCSC   Ensembl
• Aliases: SYN10, hsyn10
• Gene name: syntaxin 10
• Alternate names: syntaxin-10,
• Gene location: 19p13.13 (228406834: 228393671)     Exons: 6     NC_000001.11
• Gene summary(Entrez): This gene belongs to the syntaxin family and encodes a soluble N-ethylmaleimide sensitive factor attachment protein receptor (SNARE). The encoded protein is involved in docking and fusion events at the Golgi apparatus. Alternative splicing results in mult
• OMIM: 603765

Protein Summary

• Protein general information: O60499  
  • Name: Syntaxin 10 (Syn10)
  • Length: 249  
  • Mass: 28114
  • Tissue specificity: Expressed at high levels in heart, skeletal muscle and pancreas.
• Sequence:

  MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGIVEANP
  GKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDASAVSATSRYIE
  EQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSD
  RRQWCAIAVLVGVLLLVLILLFSL

• Structural information:
  • Protein Domains: (157..21-)
    homology (/note="t-SNARE-coiled-coil)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00202"-)
  • Interpro: IPR010989  IPR015260  IPR006012  IPR000727  
  • Prosite: PS00914 PS50192
  • PDB: 4DND
  • PDBsum: 4DND
  • DIP: 60563
  • STRING: ENSP00000466298
• Other Databases: GeneCards:  STX10  Malacards:  STX10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000149	SNARE binding	IBA	molecular function
GO:0005484	SNAP receptor activity	IBA	molecular function
GO:0006886	intracellular protein transport	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IBA	biological process
GO:0006906	vesicle fusion	IBA	biological process
GO:0008021	synaptic vesicle	IBA	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0030285	integral component of synaptic vesicle membrane	IBA	cellular component
GO:0031201	SNARE complex	IBA	cellular component
GO:0048278	vesicle docking	IBA	biological process
GO:0042147	retrograde transport, endosome to Golgi	IDA	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005484	SNAP receptor activity	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0048193	Golgi vesicle transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0034498	early endosome to Golgi transport	IDA	NOT|biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0032880	regulation of protein localization	IMP	biological process
GO:0019905	syntaxin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray