• Gene id: 8634

Gene Summary

• Gene Symbol: RTCA   Gene   UCSC   Ensembl
• Aliases: RPC, RTC1, RTCD1
• Gene name: RNA 3'-terminal phosphate cyclase
• Alternate names: RNA 3'-terminal phosphate cyclase, RNA terminal phosphate cyclase domain 1, RNA terminal phosphate cyclase domain-containing protein 1, RTC domain-containing protein 1,
• Gene location: 1p21.2 (33132097: 33175798)     Exons: 13     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the RNA 3'-phosphate cyclase family. The encoded protein plays a role in RNA metabolism by catalyzing the ATP-dependent conversion of the 3'-phosphate of RNA substrates to a 2',3'-cyclic phosphodiester. Alternatively spliced
• OMIM: 611286

Protein Summary

• Protein general information: O00442  
  • Name: RNA 3' terminal phosphate cyclase (RNA cyclase) (RNA 3' phosphate cyclase) (EC 6.5.1.4) (RNA terminal phosphate cyclase domain containing protein 1) (RTC domain containing protein 1)
  • Length: 366  
  • Mass: 39337
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAGPRVEVDGSIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGST
  EITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFI
  FNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIYGRAFVAGVLPFKVAKDMAAAAVRCIRKEIRDL
  YVNIQPVQEPKDQAFGNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRHGGTVDEYLQDQLI
  VFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKDTYIIECQGIGMTNPNL

• Structural information:
  • Interpro: IPR013791  IPR023797  IPR037136  IPR000228  IPR017770   IPR020719  IPR013792  IPR036553  
  • Prosite: PS01287
  • STRING: ENSP00000260563
• Other Databases: GeneCards:  RTCA  Malacards:  RTCA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003963	RNA-3'-phosphate cyclase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006396	RNA processing	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0003963	RNA-3'-phosphate cyclase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016874	ligase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0003723	RNA binding	TAS	molecular function
GO:0003963	RNA-3'-phosphate cyclase activity	TAS	molecular function
GO:0003963	RNA-3'-phosphate cyclase activity	IEA	molecular function
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881