• Gene id: 8614

Gene Summary

• Gene Symbol: STC2   Gene   UCSC   Ensembl
• Aliases: STC-2, STCRP
• Gene name: stanniocalcin 2
• Alternate names: stanniocalcin-2, STC-related protein, stanniocalcin-related protein,
• Gene location: 5q35.2 (173329502: 173314722)     Exons: 3     NC_000005.10
• Gene summary(Entrez): This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The encoded protein has 10 of its 15 cysteine residues conserved among stanniocalcin family members and is
• OMIM: 603665

Protein Summary

• Protein general information: O76061  
  • Name: Stanniocalcin 2 (STC 2) (Stanniocalcin related protein) (STC related protein) (STCRP)
  • Length: 302  
  • Mass: 33249
  • Tissue specificity: Expressed in a variety of tissues including muscle, heart, pancreas, kidney, spleen, prostate, small intestine, colon and peripheral blood leukocytes.
• Sequence:

  MCAERLGQFMTLALVLATFDPARGTDATNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNS
  CEIRGLHGICMTFLHNAGKFDAQGKSFIKDALKCKAHALRHRFGCISRKCPAIREMVSQLQRECYLKHDLCAAAQ
  ENTRVIVEMIHFKDLLLHEPYVDLVNLLLTCGEEVKEAITHSVQVQCEQNWGSLCSILSFCTSAIQKPPTAPPER
  QPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDEQSEYSDI
  RR

• Structural information:
  • Interpro: IPR004978  
  • STRING: ENSP00000265087
• Other Databases: GeneCards:  STC2  Malacards:  STC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0006874	cellular calcium ion homeostasis	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0055074	calcium ion homeostasis	IEA	biological process
GO:0030968	endoplasmic reticulum unfolded protein response	IEA	biological process
GO:0006874	cellular calcium ion homeostasis	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0007566	embryo implantation	IEA	biological process
GO:0006874	cellular calcium ion homeostasis	IEA	biological process
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:2001256	regulation of store-operated calcium entry	IEA	biological process
GO:0040015	negative regulation of multicellular organism growth	IEA	biological process
GO:0034976	response to endoplasmic reticulum stress	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0046697	decidualization	IEA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0033280	response to vitamin D	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0046885	regulation of hormone biosynthetic process	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0020037	heme binding	IDA	molecular function
GO:0010629	negative regulation of gene expression	IDA	biological process
GO:0019899	enzyme binding	IDA	molecular function
GO:0005615	extracellular space	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)