• Gene id: 8612

Gene Summary

• Gene Symbol: PLPP2   Gene   UCSC   Ensembl
• Aliases: LPP2, PAP-2c, PAP2-g, PPAP2C
• Gene name: phospholipid phosphatase 2
• Alternate names: phospholipid phosphatase 2, PAP2-gamma, PAP2c, lipid phosphate phosphohydrolase 2, phosphatidate phosphohydrolase type 2c, phosphatidic acid phosphatase 2c, phosphatidic acid phosphatase type 2C, phosphatidic acid phosphohydrolase type 2c, type-2 phosphatidic aci,
• Gene location: 19p13.3 (291412: 281042)     Exons: 7     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction media
• OMIM: 607126

Protein Summary

• Protein general information: O43688  
  • Name: Phospholipid phosphatase 2 (EC 3.1.3. ) (EC 3.1.3.4) (Lipid phosphate phosphohydrolase 2) (PAP2 gamma) (PAP2 G) (Phosphatidate phosphohydrolase type 2c) (Phosphatidic acid phosphatase 2c) (PAP 2c) (PAP2c)
  • Length: 288  
  • Mass: 32574
  • Tissue specificity: Found mainly in brain, pancreas and placenta. {ECO
• Sequence:

  MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVSAGEAY
  LVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDPDWSRVNCSVYVQLEKVC
  RGNPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDV
  LVGLLQGALVAALTVCYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS

• Structural information:
  • Interpro: IPR028674  IPR036938  IPR000326  
  • STRING: ENSP00000329697
• Other Databases: GeneCards:  PLPP2  Malacards:  PLPP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042577	lipid phosphatase activity	IBA	molecular function
GO:0008195	phosphatidate phosphatase activity	IBA	molecular function
GO:0007165	signal transduction	IBA	biological process
GO:0006644	phospholipid metabolic process	IBA	biological process
GO:0046839	phospholipid dephosphorylation	IBA	biological process
GO:0016791	phosphatase activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005901	caveola	IDA	cellular component
GO:0006644	phospholipid metabolic process	IDA	biological process
GO:0008195	phosphatidate phosphatase activity	IDA	molecular function
GO:0006644	phospholipid metabolic process	IDA	biological process
GO:0008195	phosphatidate phosphatase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0046839	phospholipid dephosphorylation	IDA	biological process
GO:0042392	sphingosine-1-phosphate phosphatase activity	IDA	molecular function
GO:0006672	ceramide metabolic process	IDA	biological process
GO:0006670	sphingosine metabolic process	IDA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0046839	phospholipid dephosphorylation	IDA	biological process
GO:0106235	ceramide-1-phosphate phosphatase activity	IDA	molecular function
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0008195	phosphatidate phosphatase activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008195	phosphatidate phosphatase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0030148	sphingolipid biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902806	regulation of cell cycle G1/S phase transition	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006644	phospholipid metabolic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04072	Phospholipase D signaling pathway
hsa00564	Glycerophospholipid metabolism
hsa05231	Choline metabolism in cancer
hsa04666	Fc gamma R-mediated phagocytosis
hsa00561	Glycerolipid metabolism
hsa00600	Sphingolipid metabolism
hsa00565	Ether lipid metabolism
hsa04975	Fat digestion and absorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq