• Gene id: 8555

Gene Summary

• Gene Symbol: CDC14B   Gene   UCSC   Ensembl
• Aliases: CDC14B3, Cdc14B1, Cdc14B2, hCDC14B
• Gene name: cell division cycle 14B
• Alternate names: dual specificity protein phosphatase CDC14B, CDC14 cell division cycle 14 homolog B,
• Gene location: 9q22.32-q22.33 (96619842: 96492742)     Exons: 24     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation
• OMIM: 603505

Protein Summary

• Protein general information: O60729  
  • Name: Dual specificity protein phosphatase CDC14B (EC 3.1.3.16) (EC 3.1.3.48) (CDC14 cell division cycle 14 homolog B)
  • Length: 498  
  • Mass: 56802
• Sequence:

  MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHYFS
  IDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEE
  AYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFI
  AFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFL
  DICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFR
  QKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTVI
  LQSSVQSCKTSEPNISGSAGITKRTTRSASRKSSVKSLSISRTKTVLR

• Structural information:
  • Interpro: IPR029260  IPR000340  IPR029021  IPR016130  IPR003595   IPR000387  IPR020422  
  • Prosite: PS00383 PS50056 PS50054
  • PDB: 1OHC 1OHD 1OHE
  • PDBsum: 1OHC 1OHD 1OHE
  • STRING: ENSP00000364389
• Other Databases: GeneCards:  CDC14B  Malacards:  CDC14B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060271	cilium assembly	IBA	biological process
GO:0007096	regulation of exit from mitosis	IBA	biological process
GO:0005813	centrosome	IBA	cellular component
GO:0005730	nucleolus	IBA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IBA	molecular function
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0072686	mitotic spindle	IBA	cellular component
GO:0071850	mitotic cell cycle arrest	IBA	biological process
GO:0032467	positive regulation of cytokinesis	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IBA	molecular function
GO:0000922	spindle pole	IBA	cellular component
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0072425	signal transduction involved in G2 DNA damage checkpoint	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:1904668	positive regulation of ubiquitin protein ligase activity	IMP	biological process
GO:0006470	protein dephosphorylation	IMP	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0006470	protein dephosphorylation	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle

Diseases

Associated diseases	References
renal cell carcinoma	PMID:24619757
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)