• Gene id: 85474

Gene Summary

• Gene Symbol: LBX2   Gene   UCSC   Ensembl
• Aliases: LP3727
• Gene name: ladybird homeobox 2
• Alternate names: transcription factor LBX2, ladybird homeobox protein homolog 2, ladybird-like homeobox 2, ladybird-like homeodomain protein 2,
• Gene location: 2p13.1 (74503315: 74497516)     Exons: 3     NC_000002.12
• OMIM: 607164

Protein Summary

• Protein general information: Q6XYB7  
  • Name: Transcription factor LBX2 (Ladybird homeobox protein homolog 2)
  • Length: 198  
  • Mass: 21,482
• Sequence:

  MNSGREPRTPRTLLSIADILAPRMVPRAPSAPQLPESGPGPTSPLCALEELTSKTFRGLDARALQPSEGRAGPDA
  LGPGPFGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKRDVEEMRAD
  VASLRALSPEVLCSLALPEGAPDPGLCLGPAGPDSRPHLSDEEIQVDD

• Structural information:
  • Interpro: IPR009057  IPR001356  
  • Prosite: PS50071
  • CDD: cd00086
  • STRING: ENSP00000417116
• Other Databases: GeneCards:  LBX2  Malacards:  LBX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process

Diseases

Associated diseases	References
Spermatogenesis defects	MIK: 24524831
Male factor infertility	MIK: 24524831
Male infertility, Spermatogenetic defects	MIK: 24524831
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24524831	Male infertility, Spermatogenetic defects			40 (30 infertile men with normal CFTR and AZF tests and karyotype, 10 fertile male controls)	Male infertility
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray