• Gene id: 85453

Gene Summary

• Gene Symbol: TSPYL5   Gene   UCSC   Ensembl
• Gene name: TSPY like 5
• Alternate names: testis-specific Y-encoded-like protein 5, TSPY-like protein 5,
• Gene location: 8q22.1 (97277927: 97273487)     Exons: 1     NC_000008.11
• OMIM: 614721

Protein Summary

• Protein general information: Q86VY4  
  • Name: Testis specific Y encoded like protein 5 (TSPY like protein 5)
  • Length: 417  
  • Mass: 45143
• Sequence:

  MSGRSRGRKSSRAKNRGKGRAKARVRPAPDDAPRDPDPSQYQSLGEDTQAAQVQAGAGWGGLEAAASAQLLRLGE
  EAACRLPLDCGLALRARAAGDHGQAAARPGPGKAASLSERLAADTVFVGTAGTVGRPKNAPRVGNRRGPAGKKAP
  ETCSTAGRGPQVIAGGRQKKGAAGENTSVSAGEEKKEERDAGSGPPATEGSMDTLENVQLKLENMNAQADRAYLR
  LSRKFGQLRLQHLERRNHLIQNIPGFWGQAFQNHPQLASFLNSQEKEVLSYLNSLEVEELGLARLGYKIKFYFDR
  NPYFQNKVLIKEYGCGPSGQVVSRSTPIQWLPGHDLQSLSQGNPENNRSFFGWFSNHSSIESDKIVEIINEELWP
  NPLQFYLLSEGARVEKGKEKEGRQGPGKQPMETTQPGVSQSN

• Structural information:
  • Interpro: IPR037231  IPR002164  
  • STRING: ENSP00000322802
• Other Databases: GeneCards:  TSPYL5  Malacards:  TSPYL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	IBA	molecular function
GO:0042393	histone binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0031398	positive regulation of protein ubiquitination	IDA	biological process
GO:0071480	cellular response to gamma radiation	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0051897	positive regulation of protein kinase B signaling	IMP	biological process
GO:0006334	nucleosome assembly	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0040008	regulation of growth	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)