• Gene id: 85451

Gene Summary

• Gene Symbol: UNK   Gene   UCSC   Ensembl
• Aliases: UNKEMPT, ZC3H5, ZC3HDC5
• Gene name: unk zinc finger
• Alternate names: RING finger protein unkempt homolog, unk family zinc finger, unkempt family zinc finger, unkempt homolog, zinc finger CCCH domain-containing protein 5, zinc finger CCCH-type containing 5, zinc finger CCCH-type domain containing 5,
• Gene location: 17q25.1 (53677545: 53665159)     Exons: 10     NC_000012.12
• OMIM: 616375

Protein Summary

• Protein general information: Q9C0B0  
  • Name: RING finger protein unkempt homolog (Zinc finger CCCH domain containing protein 5)
  • Length: 810  
  • Mass: 88084
• Sequence:

  MSKGPGPGGSAASSAPPAATAQVLQAQPEKPQHYTYLKEFRTEQCPLFVQHKCTQHRPYTCFHWHFVNQRRRRSI
  RRRDGTFNYSPDVYCTKYDEATGLCPEGDECPFLHRTTGDTERRYHLRYYKTGICIHETDSKGNCTKNGLHCAFA
  HGPHDLRSPVYDIRELQAMEALQNGQTTVEGSIEGQSAGAASHAMIEKILSEEPRWQETAYVLGNYKTEPCKKPP
  RLCRQGYACPYYHNSKDRRRSPRKHKYRSSPCPNVKHGDEWGDPGKCENGDACQYCHTRTEQQFHPEIYKSTKCN
  DMQQSGSCPRGPFCAFAHVEQPPLSDDLQPSSAVSSPTQPGPVLYMPSAAGDSVPVSPSSPHAPDLSALLCRNSS
  LGSPSNLCGSPPGSIRKPPNLEGIVFPGESGLAPGSYKKAPGFEREDQVGAEYLKNFKCQAKLKPHSLEPRSQEQ
  PLLQPKQDMLGILPAGSPLTSSISSSITSSLAATPPSPVGTSSVPGMNANALPFYPTSDTVESVIESALDDLDLN
  EFGVAALEKTFDNSTVPHPGSITIGGSLLQSSAPVNIPGSLGSSASFHSASPSPPVSLSSHFLQQPQGHLSQSEN
  TFLGTSASHGSLGLNGMNSSIWEHFASGSFSPGTSPAFLSGPGAAELARLRQELDEANSTIKQWEESWKQAKQAC
  DAWKKEAEEAGERASAAGAECELAREQRDALEVQVKKLQEELERLHAGPEPQALPAFSDLEALSLSTLYSLQKQL
  RAHLEQVDKAVFHMQSVKCLKCQEQKRAVLPCQHAALCELCAEGSECPICQPGRAHTLQS

• Structural information:
  • Interpro: IPR040594  IPR000571  IPR036855  
  • Prosite: PS50103
  • STRING: ENSP00000464893
• Other Databases: GeneCards:  UNK  Malacards:  UNK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990715	mRNA CDS binding	IBA	molecular function
GO:0048667	cell morphogenesis involved in neuron differentiation	IBA	biological process
GO:0005844	polysome	IDA	cellular component
GO:0048667	cell morphogenesis involved in neuron differentiation	IMP	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0001764	neuron migration	IEA	biological process
GO:1990715	mRNA CDS binding	IEA	molecular function
GO:0001701	in utero embryonic development	IEA	biological process
GO:0048667	cell morphogenesis involved in neuron differentiation	IEA	biological process
GO:1905538	polysome binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:1990715	mRNA CDS binding	IDA	molecular function
GO:2000766	negative regulation of cytoplasmic translation	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)