• Gene id: 85450

Gene Summary

• Gene Symbol: ITPRIP   Gene   UCSC   Ensembl
• Aliases: DANGER, KIAA1754, bA127L20, bA127L20.2
• Gene name: inositol 1,4,5-trisphosphate receptor interacting protein
• Alternate names: inositol 1,4,5-trisphosphate receptor-interacting protein, inositol 1,4,5-triphosphate receptor-interacting protein,
• Gene location: 10q25.1 (104338464: 104309695)     Exons: 18     NC_000010.11
• Gene summary(Entrez): This gene encodes a membrane-associated protein that binds the inositol 1,4,5-trisphosphate receptor (ITPR). The encoded protein enhances the sensitivity of ITPR to intracellular calcium signaling. Alternative splicing results in multiple transcript varia

Protein Summary

• Protein general information: Q8IWB1  
  • Name: Inositol 1,4,5 trisphosphate receptor interacting protein (Protein DANGER)
  • Length: 547  
  • Mass: 62060
  • Tissue specificity: Detected in brain where it is concentrated in cerebellar Purkinje cells (at protein level). {ECO
• Sequence:

  MAMGLFRVCLVVVTAIINHPLLFPRENATVPENEEEIIRKMQAHQEKLQLEQLRLEEEVARLAAEKEALEQVAEE
  GRQQNETRVAWDLWSTLCMILFLMIEVWRQDHQEGPSPECLGGEEDELPGLGGAPLQGLTLPNKATLGHFYERCI
  RGATADAARTREFLEGFVDDLLEALRSLCNRDTDMEVEDFIGVDSMYENWQVDRPLLCHLFVPFTPPEPYRFHPE
  LWCSGRSVPLDRQGYGQIKVVRADGDTLSCICGKTKLGEDMLCLLHGRNSMAPPCGDMENLLCATDSLYLDTMQV
  MKWFQTALTRAWKGIAHKYEFDLAFGQLDSPGSLKIKFRSGKFMPFNLIPVIQCDDSDLYFVSHLPREPSEGTPA
  SSTDWLLSFAVYERHFLRTTLKALPEGACHLSCLQIASFLLSKQSRLTGPSGLSSYHLKTALLHLLLLRQAADWK
  AGQLDARLHELLCFLEKSLLQKKLHHFFIGNRKVPEAMGLPEAVLRAEPLNLFRPFVLQRSLYRKTLDSFYEMLK
  NAPALISEYSLHVPSDQPTPKS

• Structural information:
  • Interpro: IPR024797  IPR026250  IPR024810  
  • STRING: ENSP00000278071
• Other Databases: GeneCards:  ITPRIP  Malacards:  ITPRIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004860	protein kinase inhibitor activity	IBA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:0004860	protein kinase inhibitor activity	IEA	molecular function
GO:0005640	nuclear outer membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005640	nuclear outer membrane	IEA	cellular component
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0005640	nuclear outer membrane	ISS	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881