• Gene id: 85377

Gene Summary

• Gene Symbol: MICALL1   Gene   UCSC   Ensembl
• Aliases: MICAL-L1, MIRAB13
• Gene name: MICAL like 1
• Alternate names: MICAL-like protein 1, molecule interacting with Rab13,
• Gene location: 22q13.1 (37906175: 37942821)     Exons: 18     NC_000022.11
• OMIM: 607189

Protein Summary

• Protein general information: Q8N3F8  
  • Name: MICAL like protein 1 (Molecule interacting with Rab13) (MIRab13)
  • Length: 863  
  • Mass: 93441
• Sequence:

  MAGPRGALLAWCRRQCEGYRGVEIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVFENNRLAFEVAEKELG
  IPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFCSPGQAGVSPPRKGLAPCSPPSVAPTPVEPEDVAQGEELSSGS
  LSEQGTGQTPSSTCAACQQHVHLVQRYLADGRLYHRHCFRCRRCSSTLLPGAYENGPEEGTFVCAEHCARLGPGT
  RSGTRPGPFSQPKQQHQQQLAEDAKDVPGGGPSSSAPAGAEADGPKASPEARPQIPTKPRVPGKLQELASPPAGR
  PTPAPRKASESTTPAPPTPRPRSSLQQENLVEQAGSSSLVNGRLHELPVPKPRGTPKPSEGTPAPRKDPPWITLV
  QAEPKKKPAPLPPSSSPGPPSQDSRQVENGGTEEVAQPSPTASLESKPYNPFEEEEEDKEEEAPAAPSLATSPAL
  GHPESTPKSLHPWYGITPTSSPKTKKRPAPRAPSASPLALHASRLSHSEPPSATPSPALSVESLSSESASQTAGA
  ELLEPPAVPKSSSEPAVHAPGTPGNPVSLSTNSSLASSGELVEPRVEQMPQASPGLAPRTRGSSGPQPAKPCSGA
  TPTPLLLVGDRSPVPSPGSSSPQLQVKSSCKENPFNRKPSPAASPATKKATKGSKPVRPPAPGHGFPLIKRKVQA
  DQYIPEEDIHGEMDTIERRLDALEHRGVLLEEKLRGGLNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQN
  LEQRQADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEF
  QREAEPEGKKKGKFKTMKMLKLLGNKRDAKSKSPRDKS

• Structural information:
  • Protein Domains: (2..10-)
    (/note="Calponin-homology-(CH))
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00044-)
    (162..22-)
    (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (671..81-)
    (/note="bMERB-)
    (/evidence="ECO:0000255|PROS-)
  • Interpro: IPR022735  IPR001715  IPR036872  IPR028563  IPR001781  
  • Prosite: PS51848 PS50021 PS00478 PS50023
  • CDD: cd00014
  • PDB: 2KSP
  • PDBsum: 2KSP
  • STRING: ENSP00000215957
• Other Databases: GeneCards:  MICALL1  Malacards:  MICALL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0005815	microtubule organizing center	IBA	cellular component
GO:0031941	filamentous actin	IBA	cellular component
GO:0055038	recycling endosome membrane	IDA	NOT|cellular component
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0019898	extrinsic component of membrane	IDA	cellular component
GO:0005802	trans-Golgi network	IDA	NOT|cellular component
GO:0097320	plasma membrane tubulation	IDA	biological process
GO:0070300	phosphatidic acid binding	IDA	molecular function
GO:0005770	late endosome	IDA	cellular component
GO:0005769	early endosome	IDA	NOT|cellular component
GO:1990126	retrograde transport, endosome to plasma membrane	IMP	biological process
GO:0031175	neuron projection development	ISS	biological process
GO:0017137	Rab GTPase binding	IPI	molecular function
GO:0017137	Rab GTPase binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0036010	protein localization to endosome	IMP	biological process
GO:0032458	slow endocytic recycling	IMP	biological process
GO:0006898	receptor-mediated endocytosis	IMP	biological process
GO:0006897	endocytosis	IMP	biological process
GO:0006612	protein targeting to membrane	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0032456	endocytic recycling	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006897	endocytosis	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031175	neuron projection development	IEA	biological process
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:1990090	cellular response to nerve growth factor stimulus	IEA	biological process
GO:0031175	neuron projection development	IEA	biological process
GO:0036010	protein localization to endosome	IEA	biological process
GO:0010008	endosome membrane	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq