• Gene id: 85364

Gene Summary

• Gene Symbol: ZCCHC3   Gene   UCSC   Ensembl
• Aliases: C20orf99
• Gene name: zinc finger CCHC-type containing 3
• Alternate names: zinc finger CCHC domain-containing protein 3, zinc finger, CCHC domain containing 3,
• Gene location: 20p13 (297569: 300320)     Exons: 1     NC_000020.11
• OMIM: 618326

Protein Summary

• Protein general information: Q9NUD5  
  • Name: Zinc finger CCHC domain containing protein 3
  • Length: 403  
  • Mass: 43547
• Sequence:

  MATGGGAEEERKRGRPQLLPPARPAARGEEADGGREKMGWAQVVKNLAEKKGEFREPRPPRREEESGGGGGSAGL
  GGPAGLAAPDLGDFPPAGRGDPKGRRRDPAGEAVDPRKKKGAAEAGRRKKAEAAAAAMATPARPGEAEDAAERPL
  QDEPAAAAGPGKGRFLVRICFQGDEGACPTRDFVVGALILRSIGMDPSDIYAVIQIPGSREFDVSFRSAEKLALF
  LRVYEEKREQEDCWENFVVLGRSKSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCE
  IELRQGEGGVRHLPGAFFLGAERGYSWYKGQPKTCFKCGSRTHMSGSCTQDRCFRCGEEGHLSPYCRKGIVCNLC
  GKRGHAFAQCPKAVHNSVAAQLTGVAGH

• Structural information:
  • Interpro: IPR042509  IPR001878  IPR036875  
  • Prosite: PS50158
  • STRING: ENSP00000484056
• Other Databases: GeneCards:  ZCCHC3  Malacards:  ZCCHC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0002218	activation of innate immune response	IDA	biological process
GO:0009597	detection of virus	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:1900246	positive regulation of RIG-I signaling pathway	IDA	biological process
GO:0009597	detection of virus	IDA	biological process
GO:0002218	activation of innate immune response	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071360	cellular response to exogenous dsRNA	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0002218	activation of innate immune response	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0002218	activation of innate immune response	IEA	biological process
GO:0032481	positive regulation of type I interferon production	IEA	biological process
GO:0071360	cellular response to exogenous dsRNA	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq