Search Result
| Gene id | 8533 | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | COPS3 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||
| Aliases | CSN3, SGN3 | ||||||||||||||||||||||||||||||||||||||||
| Gene name | COP9 signalosome subunit 3 | ||||||||||||||||||||||||||||||||||||||||
| Alternate names | COP9 signalosome complex subunit 3, COP9 complex subunit 3, COP9 constitutive photomorphogenic homolog subunit 3, JAB1-containing signalosome subunit 3, signalosome subunit 3, | ||||||||||||||||||||||||||||||||||||||||
| Gene location |
17p11.2 (6588638: 6654981) Exons: 5 NC_000006.12 |
||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun. It acts as a docking site for complex-mediated phosphorylation. The gene is locat |
||||||||||||||||||||||||||||||||||||||||
| OMIM | 604665 | ||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9UNS2 Name: COP9 signalosome complex subunit 3 (SGN3) (Signalosome subunit 3) (JAB1 containing signalosome subunit 3) Length: 423 Mass: 47873 Tissue specificity: Widely expressed. Expressed at high level in heart and skeletal muscle. {ECO | ||||||||||||||||||||||||||||||||||||||||
| Sequence |
MASALEQFVNSVRQLSAQGQMTQLCELINKSGELLAKNLSHLDTVLGALDVQEHSLGVLAVLFVKFSMPSVPDFE TLFSQVQLFISTCNGEHIRYATDTFAGLCHQLTNALVERKQPLRGIGILKQAIDKMQMNTNQLTSIHADLCQLCL LAKCFKPALPYLDVDMMDICKENGAYDAKHFLCYYYYGGMIYTGLKNFERALYFYEQAITTPAMAVSHIMLESYK KYILVSLILLGKVQQLPKYTSQIVGRFIKPLSNAYHELAQVYSTNNPSELRNLVNKHSETFTRDNNMGLVKQCLS SLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHN IDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS | ||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: COPS3  Malacards: COPS3 | ||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||