• Gene id: 8531

Gene Summary

• Gene Symbol: YBX3   Gene   UCSC   Ensembl
• Aliases: CSDA, CSDA1, DBPA, ZONAB
• Gene name: Y-box binding protein 3
• Alternate names: Y-box-binding protein 3, DNA-binding protein A, ZO-1-associated nucleic acid-binding protein, cold shock domain-containing protein A, cold-shock domain containing A1, cold-shock domain protein A, single-strand DNA-binding protein NF-GMB,
• Gene location: 12p13.2 (135965672: 136149614)     Exons: 17     NC_000003.12
• OMIM: 603437

Protein Summary

• Protein general information: P16989  
  • Name: Y box binding protein 3 (Cold shock domain containing protein A) (DNA binding protein A) (Single strand DNA binding protein NF GMB)
  • Length: 372  
  • Mass: 40090
  • Tissue specificity: Highly expressed in skeletal muscle and heart.
• Sequence:

  MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLAT
  AAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEK
  GAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRR
  PQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPR
  PAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTENPAPPTQQSSAE

• Structural information:
  • Protein Domains: (93..15-)
    (/note="CSD"-)
  • Interpro: IPR011129  IPR019844  IPR002059  IPR012340  
  • Prosite: PS00352 PS51857
  • CDD: cd04458
  • DIP: 42489
  • STRING: ENSP00000228251
• Other Databases: GeneCards:  YBX3  Malacards:  YBX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0003676	nucleic acid binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003690	double-stranded DNA binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0009566	fertilization	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:1905538	polysome binding	IEA	molecular function
GO:0048642	negative regulation of skeletal muscle tissue development	IEA	biological process
GO:0046622	positive regulation of organ growth	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003730	mRNA 3'-UTR binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0001701	in utero embryonic development	IEA	biological process
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0017048	Rho GTPase binding	ISS	molecular function
GO:0003730	mRNA 3'-UTR binding	ISS	molecular function
GO:0005923	bicellular tight junction	ISS	cellular component
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0060546	negative regulation of necroptotic process	IMP	biological process
GO:0071356	cellular response to tumor necrosis factor	IMP	biological process
GO:0071474	cellular hyperosmotic response	IMP	biological process
GO:2000767	positive regulation of cytoplasmic translation	ISS	biological process
GO:0070935	3'-UTR-mediated mRNA stabilization	IC	biological process
GO:0005634	nucleus	ISS	cellular component
GO:1902219	negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	NAS	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04530	Tight junction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881