• Gene id: 8528

Gene Summary

• Gene Symbol: DDO   Gene   UCSC   Ensembl
• Aliases: DASOX, DDO-1, DDO-2
• Gene name: D-aspartate oxidase
• Alternate names: D-aspartate oxidase, D-aspartate oxidase, DDO, aspartic oxidase,
• Gene location: 6q21 (110415574: 110388320)     Exons: 8     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a peroxisomal flavoprotein that catalyzes the oxidative deamination of D-aspartate and N-methyl D-aspartate. Flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide can serve as the cofactor in this reaction
• OMIM: 605687

Protein Summary

• Protein general information: Q99489  
  • Name: D aspartate oxidase (DASOX) (DDO) (EC 1.4.3.1)
  • Length: 341  
  • Mass: 37535
• Sequence:

  MDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHL
  FAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTEAELKKFPQYVFGQAFTTLKCECPAYLPWL
  EKRIKGSGGWTLTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIY
  PGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPV
  VHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL

• Structural information:
  • Interpro: IPR006181  IPR023209  IPR006076  
  • Prosite: PS00677
  • STRING: ENSP00000357920
• Other Databases: GeneCards:  DDO  Malacards:  DDO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006531	aspartate metabolic process	IBA	biological process
GO:0008445	D-aspartate oxidase activity	IBA	molecular function
GO:0006533	aspartate catabolic process	IBA	biological process
GO:0003884	D-amino-acid oxidase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0071949	FAD binding	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0046416	D-amino acid metabolic process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0008445	D-aspartate oxidase activity	IEA	molecular function
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006625	protein targeting to peroxisome	TAS	biological process
GO:0034641	cellular nitrogen compound metabolic process	TAS	biological process
GO:0019478	D-amino acid catabolic process	IEA	biological process
GO:0008445	D-aspartate oxidase activity	IEA	molecular function
GO:0007320	insemination	IEA	biological process
GO:0006531	aspartate metabolic process	IEA	biological process
GO:0042445	hormone metabolic process	IEA	biological process
GO:0007625	grooming behavior	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0071949	FAD binding	IDA	molecular function
GO:0019478	D-amino acid catabolic process	IDA	biological process
GO:0008445	D-aspartate oxidase activity	IDA	molecular function
GO:0005777	peroxisome	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04146	Peroxisome
hsa00250	Alanine, aspartate and glutamate metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq